(data stored in ACNUC7421 zone)

EMBL: FM180568.PE51

FM180568.PE51        Location/Qualifiers
FT   CDS_pept        53500..53814
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0051"
FT                   /product="CcdB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07599"
FT                   /db_xref="GOA:B7UI96"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI96"
FT                   /protein_id="CAS07599.1"
FT                   /translation="MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSR
FT                   IRPPERLNPILLLVDGKEYVLMTHETATVPVNALGTKFCDASAHRTLIKGALDFMLDGI
FT                   "
     atgcaattta cggtataccg cagtcgcggc aggaacgccg cgtttccctt tgttattgat        60
     gttaccagcg acattattgg tgagattaat cgccgtatcg ttattccatt aacacctatt       120
     gaacgattta gccgtattcg cccaccagaa cggcttaacc caatcctttt actggtagac       180
     ggcaaagaat atgtgctcat gacgcatgag actgcaactg ttccagttaa cgcgctggga       240
     acgaaatttt gcgatgccag cgcgcaccga acgttgatta aaggagcatt agattttatg       300
     ctcgacggga tttaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page