(data stored in ACNUC7421 zone)

EMBL: FM180568.PE549

FM180568.PE549       Location/Qualifiers
FT   CDS_pept        609056..610933
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0549"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08097"
FT                   /db_xref="GOA:B7UKT9"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKT9"
FT                   /protein_id="CAS08097.1"
FT                   /translation="MSASSVKPLNVQLPAITLILFALCVGIFCYLAQWMSYEEVDQSAL
FT                   IHLGANVASLTLSGEPWRLLSSVFLHSSFSHLLMNMFALLAVGTVAERILGKWRLLIIW
FT                   LFSGIFGGLISACYALRESEQIVISVGASGAIMGIAGAAIATQLASGAGTHHKNQRRVF
FT                   PLLGMVALTLLYGTRQTGIDNACHIGGLIAGGALGWLSARLVGQNRLVTEGGIIVAVTL
FT                   LLTGTIWLVQQQIDESVLQVRQSLREAFYPQEIEQERRQKKQQLVEERNALRETLSAPV
FT                   SREQASGDLLAEIADIHDMAISRDANTLYAAIENTNSIVVFDLGQKKILHTFTAPIAKE
FT                   KSVKHCGGCKDQGVRSMALSLDEKLIYATSFEANALSVINVATGEIIQSITTGAHPDSL
FT                   ILSCDGTKAWVMNRTSNSVSAIDLVAYQHVADIPLEKYDGTGMSGKPGAWVMALSPDEK
FT                   TLLVPGAGRGNIVRFNTITHQKEDFPAGNARGVVSAMGFRPKNGEVIFADSQGISRIRA
FT                   EDQQASIMTQWCRRSVYSVEGISPDGQYLALVSYGLQGYVILLNINAGQIIGVYPASYV
FT                   NNLRFSADGRKIFVMAKNRLIQMDRTRSIDPQAIIRHPQYGDVACIPET"
     atgtctgcat cttcggttaa gccgttaaat gttcaattac ccgcaataac cctgatcctt        60
     tttgcgctct gtgttgggat attttgttac ctcgcacaat ggatgagtta cgaagaagtc       120
     gatcaatccg cactcatcca tctcggcgct aacgttgcct ctctcacgtt gtcgggtgaa       180
     ccctggcgct tattgagcag tgtctttctg cacagtagtt tttcccattt gctgatgaat       240
     atgtttgcac tcctggcggt ggggacagta gcggaacgga tactggggaa atggcgactc       300
     ctgattatct ggttattctc cggcatcttt ggtgggctga tcagcgcctg ttatgcgtta       360
     cgcgaaagtg agcagatagt catcagcgtt ggggcatccg gggcaattat gggaatagcg       420
     ggcgctgcga tagcaacaca gcttgcttca ggtgcgggca cacaccataa aaaccagcgg       480
     cgagtatttc ctctgttggg tatggtggcg ctgacactgt tgtatggtac ccggcaaaca       540
     ggaatagata acgcttgcca cattggcggc ctgattgcgg ggggcgcgtt gggttggctg       600
     agtgcgcgtt tagttgggca aaatcggctc gttacggaag gcgggattat tgttgcggtc       660
     actcttcttc tgaccgggac tatctggctt gtgcagcagc agattgatga atcagtttta       720
     caggtcaggc aaagcctgcg tgaagcgttt tatccgcagg agattgaaca agagcgacga       780
     caaaaaaagc agcagttagt ggaggagcgc aacgccctca gggaaacatt atccgctccg       840
     gtaagtcgtg agcaggccag tggtgattta ctcgctgaga ttgccgatat ccatgatatg       900
     gcgatcagtc gggatgctaa tacgttgtat gccgcaattg aaaacacgaa cagcattgtt       960
     gttttcgacc tcggacaaaa gaaaatcctg cataccttta cagcgcccat agcgaaagaa      1020
     aagtcagtca aacattgtgg tggctgtaaa gatcagggcg tcagatcgat ggcattaagc      1080
     ctggatgaaa agttgattta tgcgacttca tttgaagcga atgcgttatc ggtcattaac      1140
     gtggcgacgg gggagattat tcagtcgatt accaccggcg cacatcctga cagccttatc      1200
     ctctcgtgtg atggcacaaa agcctgggtg atgaatcgca ccagcaatag tgtgtcagcg      1260
     attgatctgg tggcttatca gcatgtggcg gatatcccgc tggagaaata cgacgggacg      1320
     gggatgagcg gtaaaccagg cgcctgggtt atggcacttt ccccggatga aaaaacatta      1380
     ctggttccgg gagcaggcag aggtaacatc gtgcggttca ataccatcac gcatcagaaa      1440
     gaagactttc ccgcaggtaa tgcgcgtggt gtcgtttctg cgatgggatt ccgaccaaaa      1500
     aatggtgagg ttatttttgc cgatagccag gggatttcac gtataagagc agaggatcaa      1560
     caagccagca ttatgacgca atggtgtcgc aggagcgttt attccgttga gggtattagc      1620
     ccggacggtc agtatttagc gttggtgtca tatggcctgc aaggttatgt catcctgctc      1680
     aatattaatg ccgggcagat tattggcgtt tatcctgcca gctacgttaa taatcttcgt      1740
     ttttcagcgg atggtagaaa gatatttgtt atggcgaaga acaggttaat ccaaatggac      1800
     aggacgcgct cgattgatcc gcaggcaatt attcggcatc cccaatatgg cgatgtggct      1860
     tgtatccctg aaacgtaa                                                    1878
//

If you have problems or comments...

PBIL Back to PBIL home page