(data stored in ACNUC7421 zone)

EMBL: FM180568.PE562

FM180568.PE562       Location/Qualifiers
FT   CDS_pept        complement(627456..628736)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0562"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08110"
FT                   /db_xref="GOA:B7UKV2"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKV2"
FT                   /protein_id="CAS08110.1"
FT                   /translation="MTMEMILALGILVLMIVLIMSDKMPFGAPPLLACLLLVVSGLSTV
FT                   QQAFAGFVNPSVVMIAGFMVVMAALQKTRLISNVKSAMISLVNKGSYRSYGLLLVIVML
FT                   GASLAGTGATGYYVLILSLVSTIPYSKKLPTSKLMMPLGFATNHPLLPINLALLFGVTA
FT                   TVLETAGFHQEISMGRFALVNLIMSAAFLAWSLIAYRFLPDHPIADASEDALAAREETF
FT                   NALPAWKEYCTIAAFAVSVIGMMLMNILGNIAFVIPGLAGAFVLMIDVLDFKEVRDHMG
FT                   APVILMMAGVIGVADALAGTGFTAMVGDAVAGVLGSGVSPFVFIVAFALLTSTCATFTG
FT                   SNMGSVYIFAPIAIAACTSLGLNPTAAAIAVVISGWNGGYMPIDGMPAMILGMGKYKLP
FT                   EFWVFSVPMYLIRILALCAGAVFIFPM"
     atgacaatgg aaatgatcct ggcattagga atactggtcc tgatgatcgt gctgatcatg        60
     tcggacaaaa tgccatttgg cgcaccgcca ctgcttgcgt gtttattgct ggttgtctcg       120
     ggactttcga ccgttcaaca ggcttttgcc ggattcgtca atccaagcgt ggtgatgatt       180
     gcagggttta tggtggtcat ggcagcgcta caaaaaaccc ggcttatcag caacgttaaa       240
     tctgcgatga taagcctggt caataaaggc agttaccgca gctacgggct gttgttagtc       300
     attgttatgc tgggtgccag tcttgcaggc accggcgcga ccggttatta cgtgctgatt       360
     ctgtcgctgg tatccaccat tccgtacagt aaaaagctac caacatcgaa attaatgatg       420
     cccctgggat ttgccaccaa ccacccgctt cttcctatca atctcgcgct tctctttggc       480
     gttacggcga ccgtactcga aaccgcgggt tttcatcagg agatttcgat ggggcgcttt       540
     gcgctggtga atctcatcat gtcagcggcg ttcctcgcat ggagtcttat tgcctaccgt       600
     tttcttccgg atcatcccat tgcggatgct tccgaggatg cgctggcggc acgcgaggaa       660
     acgtttaacg cccttcctgc ctggaaagaa tattgcacta ttgccgcatt cgctgtcagc       720
     gttatcggca tgatgctaat gaacattctg ggaaatatcg ccttcgttat tccgggtctt       780
     gcgggtgcgt ttgttctgat gatcgatgta ctggacttta aagaagttcg cgatcatatg       840
     ggagcgccgg tcattttaat gatggcgggg gtgatcggtg tagctgatgc actggcgggc       900
     accggcttta cggcgatggt tggcgatgcc gttgcaggtg tgctcggttc tggcgtctca       960
     ccatttgtat ttattgtcgc ctttgctttg cttaccagta cctgcgccac cttcacgggt      1020
     tcgaatatgg ggtctgttta tatttttgcc cccatcgcca ttgccgcctg taccagcctt      1080
     gggcttaacc cgaccgctgc agcgattgcg gtggtgattt caggctggaa cggcggctat      1140
     atgcctattg acggaatgcc agccatgatc ctcggaatgg ggaaatacaa acttcccgaa      1200
     ttctgggtgt tctctgtacc aatgtatctc atccgcattc tggcgctttg tgcaggcgct      1260
     gtttttatct tcccaatgta a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page