(data stored in ACNUC7421 zone)

EMBL: FM180568.PE563

FM180568.PE563       Location/Qualifiers
FT   CDS_pept        complement(628750..629220)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0563"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08111"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKV3"
FT                   /protein_id="CAS08111.1"
FT                   /translation="MIIGNLNHLSLAGLPAWVRNILLCPECSLSALSAREDGRWQPEGC
FT                   RWFCTLGTSDTQPAELRHTEYHHLWADIQVVITGCEGINAGTRPIARENDEERKPDLFI
FT                   APSPENSVAITLHPGDFAVFMPEEPHQALCAIGAATSVRKAVFKVPRDMLEA"
     atgattatcg gtaatctcaa ccatttgtcg ctggcggggc ttcccgcctg ggtgagaaat        60
     attctgctgt gcccggagtg ttcgttatcg gcgttatccg ccagagagga cggtcgctgg       120
     caacctgaag gatgtcggtg gttctgcacg ctgggaactt cagacacgca acccgccgaa       180
     ctccgccata cggagtatca ccatctgtgg gccgatatcc aggtggtgat tactggttgt       240
     gagggcatta atgcgggaac gcggcccatc gctcgcgaaa acgatgaaga acgtaagccc       300
     gatctgttta tcgccccatc ccctgaaaac agtgtcgcca tcactctaca ccccggtgat       360
     ttcgccgtct ttatgcctga ggaacctcac caggcgctgt gcgcgattgg cgcggctacg       420
     tcagtacgca aagcggtctt taaggtaccg cgcgacatgc tggaagccta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page