(data stored in ACNUC7421 zone)

EMBL: FM180568.PE564

FM180568.PE564       Location/Qualifiers
FT   CDS_pept        complement(629217..630386)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0564"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08112"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKV4"
FT                   /protein_id="CAS08112.1"
FT                   /translation="MSVALIRDGVIRPSENDSHVLTAMLPSSCPQNHAANILPMPDGAL
FT                   MCVWFAGTQEGIADISVWGSRLPAGRTQWSDAVKLSHDDTRSEQNPVLFLAPDNVLWLL
FT                   WTAQISGNQDTAIVRYRKSDDLGQTWGEIATLLDKPGTFIRQPITVLDNGNWLLPVFYC
FT                   RTQPGEKWVGNDDISAVKISADGGHSWRDVEVPQSLGCVHMNITMLHDGTLVALFRSRW
FT                   ADNIYISHSVDNGESWSVPQATELPNNNSSIQVTTLASGELALVYNAMSAAGAVERRAS
FT                   LYDEIDDGDDSRKEPTAVGRSAFWGAPRAPMTVAISADGGKSWPWRRNLDEGDGNCMTN
FT                   NSLEKLNREFSYPSIKQSPDGTLHIAYTWWRQAIKYVRISPEWVKGQAS"
     atgtctgtag cccttattcg tgacggcgtc atccgtccat ccgaaaacga ttcgcatgtg        60
     cttaccgcca tgctgccctc gtcctgcccg caaaaccacg cggcgaatat tctgccaatg       120
     ccggatggcg cattaatgtg cgtctggttt gcgggaacac aggaaggtat tgccgatatt       180
     tctgtctggg gatcacgatt gcccgctggc agaacgcagt ggagcgatgc ggtcaaactt       240
     tcccacgatg acacgcgttc agagcaaaac ccggtgctgt ttctcgcgcc ggataacgtg       300
     ctgtggctgc tatggaccgc acaaatatcc ggtaatcagg acacggccat cgtccgctac       360
     cgtaagtctg acgaccttgg gcaaacctgg ggcgagattg ccaccctgct cgataaaccc       420
     ggcacgttca ttcgccagcc gatcacggtg cttgataacg gtaactggct gcttcccgtc       480
     ttttattgcc gtacccaacc cggcgaaaaa tgggtcggca atgatgatat cagcgcagtg       540
     aaaatttccg ctgacggtgg tcactcatgg cgcgatgtcg aggtgccgca aagtctcggc       600
     tgcgttcata tgaatatcac aatgctgcac gacggtacgt tggttgctct ctttcgcagc       660
     cgttgggcag acaacatcta tatcagccat tcagtggaca acggcgagag ttggtcggtg       720
     ccgcaagcta ccgaattgcc caacaacaat tcgtctattc aggtaacgac gcttgccagc       780
     ggcgaactgg cgctggtgta caacgcgatg agtgcggcag gcgcagtaga acgtcgcgcg       840
     tcgctttatg acgaaatcga cgatggcgac gacagccgca aagaaccgac agccgtcgga       900
     cgctccgctt tctggggggc cccacgcgcg ccgatgacgg tagcgatttc tgccgatggt       960
     gggaaaagct ggccgtggcg gcgcaatctc gatgaaggcg acggcaactg catgaccaac      1020
     aattccctgg aaaagctaaa tcgtgagttc tcctacccca gcatcaaaca aagcccggac      1080
     ggtacgctac atatcgctta cacctggtgg cgtcaggcca tcaagtacgt gcgcatctcc      1140
     cccgagtggg ttaaggggca ggcatcatga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page