(data stored in ACNUC7421 zone)

EMBL: FM180568.PE566

FM180568.PE566       Location/Qualifiers
FT   CDS_pept        complement(631240..632127)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0566"
FT                   /product="dihydrodipicolinate synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08114"
FT                   /db_xref="GOA:B7UKV6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKV6"
FT                   /protein_id="CAS08114.1"
FT                   /translation="MPKTIEGVLTAIVTPFTATGSLNIPALKVQVNRQLEAGNAIFCGG
FT                   TNGEFFVLNEQEKLSVTQTCVDEVAGRAPVVAHIGEISTRETIRLGQQIEKLGVDAVSV
FT                   IAPYFVPLKQEELIAHYSAIADALSIPMFLYNIPARTGNTIQPETARALASHPNIIGIK
FT                   DSAGSDESLKGFLDAVRDIDGFNVLNGPDSLIHKGFVEGCSACISGLANIAPREINAIW
FT                   SRFHAGDIEGSYEAQESVTGLRTDLYKVAFSPAAVKKALQLMGHDVGDSRYAVNFTPEQ
FT                   ISEIQQIIRHYNIN"
     atgccgaaaa ccattgaagg tgtattaacc gctatcgtca ccccgtttac cgcgaccggc        60
     agtctgaata tcccggcgtt aaaagtgcag gtgaatcgtc aactggaagc gggtaacgcg       120
     attttttgcg gcggcaccaa cggcgaattt tttgtgttga atgaacagga gaagctcagc       180
     gttacgcaaa cctgcgtgga tgaagtggct ggtcgtgcgc cggtcgtggc acacattggc       240
     gagatctcta cgcgcgaaac gattcgtctg ggtcagcaga ttgaaaaact tggcgtagat       300
     gccgtgtcgg tcattgcccc ttacttcgta ccgctgaaac aggaagagtt gattgcgcat       360
     tacagcgcaa ttgccgacgc actgagcatt ccgatgtttc tctataacat cccggcccgc       420
     actggcaata cgatccagcc agaaaccgcg cgtgctctgg cgtcgcaccc caatatcatt       480
     gggattaaag acagcgccgg aagcgacgaa agcctgaagg gttttctcga tgcggtgcgc       540
     gacattgacg gctttaatgt gctcaacggc ccggattcgc tgatccataa agggtttgtc       600
     gagggatgtt cagcctgtat ctctgggctc gccaacatcg cgccgcgaga aatcaatgcc       660
     atctggtctc gcttccatgc cggtgatatt gaagggtctt atgaagcaca ggagagtgta       720
     acgggcctgc gtaccgatct ttataaagta gcattctccc cggctgcggt gaaaaaagcg       780
     ttgcagctta tggggcatga tgttggtgat agccgctacg cggttaattt cacgcctgaa       840
     cagatcagcg agattcaaca aattattcgt cattataaca ttaattaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page