(data stored in ACNUC7421 zone)

EMBL: FM180568.PE568

FM180568.PE568       Location/Qualifiers
FT   CDS_pept        633458..634693
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0568"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08116"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKV8"
FT                   /protein_id="CAS08116.1"
FT                   /translation="MEKGITKPSILVVADDFTGANDAGVSLAQVGHTVDVAFEMPYHGD
FT                   ASVWVINSDSRAMDPKLAAMKITSLMSHLPLANNPPLVIKKIDSTLRGNIGAEIEALMK
FT                   ACGITGAVIAPAFPQAGRTTVAGECWVNGVRITETEFASDPKTPVLSARIADIIRLQTA
FT                   IPCQPVTVSQLSHLSYEQPWIGVIDAQTDSDLDRIAAAVMQAKQPLLLVGSAGICDAVA
FT                   RRSAIMPPPTVLAIIGSMSEIAQRQIATLHSHPRITQIYVDVEHILAGNASDYDARIVQ
FT                   ALQKGDHCIVHTCNDSVARHQIDTLCQRWQMSRAALGEKICRFLGELTRQVLLRTMPDA
FT                   LYLSGGDVAMATASALGATGFRITGKVAQCVPYGHFLGGVWSRSVMTKAGGFGDETTLH
FT                   QVLNFIEEKRSE"
     atggaaaagg gaatcactaa gccgagcatt ctcgtcgttg ccgatgattt cacgggagcc        60
     aacgacgcgg gggtaagcct ggcgcaggtg gggcatacag ttgatgtggc ctttgaaatg       120
     ccttatcacg gtgatgccag cgtatgggtg attaacagcg acagccgggc gatggatcct       180
     aagctggcgg cgatgaaaat aacctcgctg atgagtcatc tccctctggc gaataacccg       240
     ccgctcgtga ttaaaaagat agattccacg cttcgaggca atatcggcgc agaaattgaa       300
     gccctgatga aggcatgcgg tataacgggc gcagtgattg cccccgcatt tcctcaggcg       360
     ggaaggacca cagtggccgg tgagtgttgg gtaaacggtg tgcggataac ggaaaccgag       420
     tttgccagcg atccgaaaac cccggtattg agcgcccgaa ttgcggacat catccggttg       480
     cagacggcca ttccatgcca gcccgttacg gtttctcagc tcagccattt gtcttatgag       540
     caaccgtgga ttggcgtgat agatgcgcag acggacagcg acctggatcg catcgctgcc       600
     gctgtgatgc aggctaaaca accgctactg ctggtcggct ccgctggtat ttgtgatgcc       660
     gttgcccggc gctccgcgat tatgccgcca cccaccgtgc tggccattat tggttcaatg       720
     agcgaaatcg ctcaacggca gatcgccaca ctgcattcac acccacgtat cacacagata       780
     tacgtcgatg ttgaacacat tctggcaggc aatgccagtg actatgacgc gcgtattgtg       840
     caggccttgc agaaaggcga ccactgcatt gtccacacct gtaacgattc tgtagcaagg       900
     catcagatcg acaccctttg ccagcgttgg cagatgagtc gcgctgcact tggggaaaaa       960
     atttgtcggt ttcttggcga acttacccgg caagttctgc ttcgcacaat gcccgatgcg      1020
     ctttatctct ctggtggcga tgtcgcaatg gcaacagcca gtgcgttagg cgcgaccggg      1080
     tttcgtatta cggggaaggt ggcgcaatgc gttccatatg gtcactttct gggcggcgtc      1140
     tggtcccgtt cggtgatgac gaaagccggt gggtttggcg atgagaccac gttgcatcag      1200
     gttctgaatt ttatcgagga gaagcgtagt gaataa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page