(data stored in ACNUC7421 zone)

EMBL: FM180568.PE613

FM180568.PE613       Location/Qualifiers
FT   CDS_pept        complement(682778..682945)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0613"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08161"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULK9"
FT                   /protein_id="CAS08161.1"
FT                   /translation="MNCSEIRLKFYEMHLLMAKPISLKCKLEVDHKYLNTPNQVNFKNL
FT                   TFMTLVDITH"
     atgaattgca gtgaaattcg acttaaattt tatgaaatgc atttactcat ggctaaaccc        60
     atatcactaa aatgcaaatt agaagtagat cacaaatacc tcaatacacc aaatcaagtt       120
     aattttaaaa atttaacatt catgacatta gttgacataa cacactga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page