(data stored in ACNUC7421 zone)

EMBL: FM180568.PE653

FM180568.PE653       Location/Qualifiers
FT   CDS_pept        complement(722437..722721)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0653"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08201"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULP9"
FT                   /protein_id="CAS08201.1"
FT                   /translation="MANLQLAVKGEYFDAMIRGEKTEEYRLCNDYWNKRIMFREYDRLI
FT                   ITKGYPKRDDSSRRIDVPYEGYEIKTIIHPHFGDKPVKVFAIKVNTGNE"
     atggctaacc tgcaacttgc cgtcaaaggt gaatacttcg atgccatgat tcgcggggag        60
     aaaacggaag agtatcgcct gtgtaatgac tactggaata agcgaattat gttccgggag       120
     tatgaccgac tgattatcac aaagggatat ccgaagcgcg acgattccag tcgcagaata       180
     gacgtcccgt atgaagggta tgaaatcaag acaatcatac atccacactt cggtgataaa       240
     ccggtaaagg tgttcgcgat aaaggtgaat accggcaatg aataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page