(data stored in ACNUC7421 zone)

EMBL: FM180568.PE654

FM180568.PE654       Location/Qualifiers
FT   CDS_pept        complement(722714..723346)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0654"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08202"
FT                   /db_xref="InterPro:IPR007539"
FT                   /db_xref="UniProtKB/TrEMBL:B7UG70"
FT                   /protein_id="CAS08202.1"
FT                   /translation="MTTITREQAQKIIEAADEVISALAGTNEDVHPGSDNMLRLWDDLN
FT                   DRYAPPEVVRELARIALASLEAEPVSQTYNLPELIEGMEVSIDVSTCDADLGNRYFGTV
FT                   TEALELDTAKNGYILLVQDAEPNFDVNGNSPVIPGGWISCSERMPDSKTAVLVAREFDR
FT                   KGDWRMKWATYIPGHPDANDGWVIPGASWIPSHWMPLPEPPQEVNHG"
     atgaccacta ttaccagaga acaggcacag aaaattattg aagcagccga tgaggttatt        60
     agtgcgcttg ccggaactaa cgaggatgtt caccctggta gcgataacat gctacgcctg       120
     tgggatgacc tgaatgaccg ttacgcgccc cctgaagttg tgcgtgagct ggcacgaatt       180
     gcactggcat cactggaagc agagcctgta agccaaactt acaacttgcc agaattaatc       240
     gaagggatgg aagtttccat tgatgtaagc acttgtgatg ctgatttagg taatcgctat       300
     ttcggtaccg tcaccgaggc gttagaactt gatacagcca agaatggtta catcctccta       360
     gttcaggacg cagagccaaa cttcgatgta aatggcaact ctccggtaat tccgggcggt       420
     tggataagct gtagtgagcg aatgccggat agcaaaacag ccgttcttgt tgccagggag       480
     tttgacagga aaggtgactg gcgaatgaaa tgggcgactt acatcccggg gcatcctgac       540
     gctaatgatg ggtgggtaat acctggtgcg tcgtggatac catcacactg gatgccgcta       600
     ccagaaccgc cgcaggaggt taaccatggc taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page