(data stored in ACNUC7421 zone)

EMBL: FM180568.PE655

FM180568.PE655       Location/Qualifiers
FT   CDS_pept        complement(723357..723554)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0655"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08203"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULQ1"
FT                   /protein_id="CAS08203.1"
FT                   /translation="MDKNTTAYWNLSLDTECPKCGHNFDLLCDADFWEFSGAKQACEEI
FT                   KGYETCCPECNHEFKTDFVY"
     atggataaaa acaccactgc ttactggaat ctgtcacttg ataccgaatg cccaaaatgc        60
     ggtcacaatt tcgatctgct ttgtgacgct gatttctggg agttttctgg agctaaacag       120
     gcatgtgaag aaataaaagg ttacgaaaca tgctgtccag aatgtaacca tgaatttaaa       180
     acagatttcg tgtattga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page