(data stored in ACNUC7421 zone)

EMBL: FM180568.PE656

FM180568.PE656       Location/Qualifiers
FT   CDS_pept        complement(723556..723951)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0656"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08204"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULQ2"
FT                   /protein_id="CAS08204.1"
FT                   /translation="MTTITKERLLTIKQWRETYGPGSNVVLPAEEAEELARIALASLEV
FT                   EPIGFRCRRNDNLGDWSYVYHREPDDFERKHLVIEGIYAAPPAQVVPEEKPMPNPLSMY
FT                   AVDAVAAIAEVRGWNACRAAMLQGKGD"
     atgaccacta ttaccaaaga gcgactgctg acaatcaagc agtggcgcga aacatacgga        60
     ccgggtagca acgttgtact gccagcagaa gaagcggaag aactggcacg aattgctctg       120
     gcatcgctgg aagtcgagcc gataggtttc cgttgcaggc gcaatgataa ccttggtgat       180
     tggagttacg tatatcatcg agagccagat gattttgagc gcaaacattt agtgatagag       240
     ggcatttacg ccgcccctcc agcgcaagta gtaccggaag aaaaaccaat gcctaatcct       300
     cttagcatgt acgcggttga tgctgttgcc gctattgcag aggtgagagg ctggaacgcc       360
     tgccgtgccg ctatgcttca ggggaaagga gactga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page