(data stored in ACNUC7421 zone)

EMBL: FM180568.PE657

FM180568.PE657       Location/Qualifiers
FT   CDS_pept        complement(723970..724101)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0657"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08205"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULQ3"
FT                   /protein_id="CAS08205.1"
FT                   /translation="MRDTNDYSSGEGENNNCSHYSRKSRISINRKVRPASRAKAAKC"
     ttgcgagata cgaatgatta ttcgtctggc gagggggaaa acaataactg ctctcattac        60
     tccagaaaat ctcgcattag cattaaccgg aaagtcagac ctgccagtag agctaaagct       120
     gcgaaatgtt ga                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page