(data stored in ACNUC7421 zone)

EMBL: FM180568.PE658

FM180568.PE658       Location/Qualifiers
FT   CDS_pept        complement(724147..724785)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0658"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08206"
FT                   /db_xref="InterPro:IPR025153"
FT                   /db_xref="UniProtKB/TrEMBL:B7UG68"
FT                   /protein_id="CAS08206.1"
FT                   /translation="MSKIDHQALREAAEQAMHDDWGFDADLFHELVTPSIVLELLDEQE
FT                   RNQQYIKRRDQENEEIALTVGKLRVELEAAENNLIDSECHVAELEEALRDKQALLEASE
FT                   KRNAKLQSENAYIRNRYKELDLLIGKNILVMQAAIIEWQATGDAKSGLAWIYNTLFGPG
FT                   ELPDESEKDAQAYFNRKYAPIDEKLMALHKWFWEQSEAERAAGIRIKGE"
     gtgagcaaaa ttgaccatca ggcactgcgt gaggcggcag agcaggcaat gcatgacgac        60
     tggggatttg acgcggacct tttccatgag ctggtaacac catcgattgt gctggaactg       120
     ctggatgaac aggaaagaaa ccagcaatac atcaaacgcc gcgaccagga gaacgaggag       180
     attgcgctta cggttgggaa gctgcgtgtt gagcttgaag cagcagagaa caaccttatt       240
     gatagtgaat gccatgttgc tgaactggaa gaagctctac gcgataagca ggcgttactt       300
     gaagcctcag aaaagcgcaa cgcaaaatta caaagcgaga atgcatacat ccgcaaccgg       360
     tacaaagaac tggacctatt aatcgggaaa aacattctgg tcatgcaggc tgccattatc       420
     gaatggcagg caactggcga cgctaagagc ggactagcat ggatttataa cacactgttt       480
     ggccctggcg aattaccgga cgaatctgag aaagatgctc aggcctactt taatcgcaaa       540
     tatgcaccga ttgacgaaaa gcttatggcg cttcacaagt ggttttggga acaaagtgaa       600
     gccgagcgcg ccgctggcat tcgcatcaaa ggagagtga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page