(data stored in ACNUC7421 zone)

EMBL: FM180568.PE659

FM180568.PE659       Location/Qualifiers
FT   CDS_pept        complement(724772..725041)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0659"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08207"
FT                   /db_xref="UniProtKB/TrEMBL:B7UG67"
FT                   /protein_id="CAS08207.1"
FT                   /translation="MSESKCQINGNKIEPCAALAKSLEYGNPTFKSKGIFIPERVNINT
FT                   GESCIDIAQIHSGKYIGRGVAMCFCPFCGESLKTWEAEAASEQN"
     gtgagtgagt caaaatgcca aattaatggc aacaagatag aaccgtgcgc ggcgttggca        60
     aaatctctcg aatatggaaa tccaacattc aagagtaaag gcatatttat cccggagcgt       120
     gtgaacataa acaccggcga gtcatgcata gatattgctc aaattcactc ggggaaatat       180
     atcggtcgtg gcgttgcaat gtgcttttgc ccgttctgtg gtgaaagttt gaaaacgtgg       240
     gaagcggagg cagccagtga gcaaaattga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page