(data stored in ACNUC7421 zone)

EMBL: FM180568.PE660

FM180568.PE660       Location/Qualifiers
FT   CDS_pept        complement(725038..725205)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0660"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08208"
FT                   /db_xref="InterPro:IPR020295"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULQ6"
FT                   /protein_id="CAS08208.1"
FT                   /translation="MRGLAYNPGILPAEMIIRQRVKPMPSREELLKRNSSPSVNQNKYL
FT                   NAMWRKGGNQ"
     atgagaggac ttgcatacaa tcccggcatt cttccggcag aaatgattat tcgccaacgc        60
     gtaaagccaa tgccatcgag agaggaattg cttaagagaa attcttctcc gtcagtgaat       120
     caaaacaaat atctgaatgc gatgtggcgc aaaggaggca accagtga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page