(data stored in ACNUC7421 zone)

EMBL: FM180568.PE661

FM180568.PE661       Location/Qualifiers
FT   CDS_pept        complement(725216..725512)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0661"
FT                   /product="predicted anti-RecBCD protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08209"
FT                   /db_xref="InterPro:IPR020500"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULQ7"
FT                   /protein_id="CAS08209.1"
FT                   /translation="MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKE
FT                   FRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEYIDPRLRNYRSRYGAISND"
     atgccagcgc ctctgtatgg tgcggatgac ccgcgccgct gttccggcaa ttccgtatcg        60
     gaggtgctgg ataaattcag aaaaaactac gatcgaataa tgtctctacc gcaggaaacg       120
     aaagaggaaa aggaatttcg ccactgtata tggcttgcag agaaagaaga acgcgagcga       180
     atttaccaga catcaatccg accattccgc aaagccacat atacccactt ccctgaatat       240
     atcgacccgc gcctgcgtaa ttaccgctca cgctatggcg ctatcagtaa tgactga          297
//

If you have problems or comments...

PBIL Back to PBIL home page