(data stored in ACNUC7421 zone)

EMBL: FM180568.PE662

FM180568.PE662       Location/Qualifiers
FT   CDS_pept        complement(725526..726032)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0662"
FT                   /product="predicted single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08210"
FT                   /db_xref="GOA:B7UG65"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B7UG65"
FT                   /protein_id="CAS08210.1"
FT                   /translation="MSSRGINKVIILGRVGQDPEVRYSPSGTAFANLTIATSEQWRDKN
FT                   TGEQKELTEWHRVAVSGKLAEVVGQYVKKGDQIYFEGMLRTRKWKDQSGQDRYTTEVHV
FT                   GINGVMQMLGGIGDSKQQAASRQSQKPQQQSSPAQHNEPPMDFDDDIPFAPVTLPFPRH
FT                   AIHAI"
     atgagttctc gcgggataaa taaggtgatt atccttggtc gggtaggaca agacccggaa        60
     gttcgatact caccatcagg aacagcgttc gctaacctga caatagccac gtcagaacaa       120
     tggcgagata aaaatactgg cgagcaaaag gaattgactg aatggcatcg tgttgctgta       180
     tccgggaaac tggctgaggt cgtggggcag tatgtgaaaa aaggtgatca gatttatttc       240
     gagggaatgc tgagaaccag aaagtggaaa gaccagtcag ggcaagaccg ttacacaacc       300
     gaggttcatg tcggaattaa tggcgtgatg caaatgcttg gcggcattgg cgacagcaaa       360
     caacaagcag ccagcaggca atcacagaag ccacagcagc aatcatcacc agcacaacac       420
     aacgaacctc cgatggattt tgacgacgat ataccctttg caccagtaac tctccccttc       480
     cctcgtcacg ctattcacgc aatttaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page