(data stored in ACNUC7421 zone)

EMBL: FM180568.PE663

FM180568.PE663       Location/Qualifiers
FT   CDS_pept        complement(726029..726496)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0663"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08211"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B7UG64"
FT                   /protein_id="CAS08211.1"
FT                   /translation="MSHLDGIIKRFESSYKVNETTGCWESTYSKNKGGYTKFVAFGVTM
FT                   LSHRVAFELYHSPIPSGKMVCHKCDNQCCVNPEHLFLGSAQENMDDKIAKGRHRGAKKG
FT                   HAHHGAKLTEWQVIEIRKRLSEKESQYKIAKDMGVSQSIISNIKTGKRWSK"
     atgtctcact tggacggaat tattaaaaga ttcgagtcca gctacaaagt taatgaaaca        60
     acaggttgct gggagtctac ctattcaaaa aacaaaggag gatacacaaa atttgtagcc       120
     tttggcgtaa caatgctttc tcatcgggtt gcttttgagc tttatcactc ccccattcca       180
     tctgggaaga tggtttgcca caaatgcgat aaccaatgct gcgttaatcc tgaacatctc       240
     tttttaggta gcgcgcaaga aaacatggac gacaagatag caaaaggaag gcatcgtgga       300
     gccaagaaag gtcatgctca tcatggtgca aaattaacag agtggcaggt tatagaaatt       360
     aggaaaagac tctctgaaaa agagagtcag tacaagatag caaaagacat gggtgtatct       420
     caatcaatta taagcaacat aaaaactggc aagaggtgga gcaaatga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page