(data stored in ACNUC7421 zone)

EMBL: FM180568.PE664

FM180568.PE664       Location/Qualifiers
FT   CDS_pept        complement(726497..727204)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0664"
FT                   /product="predicted recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08212"
FT                   /db_xref="InterPro:IPR041247"
FT                   /db_xref="UniProtKB/TrEMBL:B7UG63"
FT                   /protein_id="CAS08212.1"
FT                   /translation="MDLNKFDEPFSPEDIEWRIQQSGKTRDGKVWAMVLAYVTNRAIMK
FT                   RLDDVCGKAGWRNEYRDIPNNGGVECGISIRIDSEWVTKWDAAENTQVEAVKGGRSGAM
FT                   KRAAVQWGIGRYLYNLEEGFAQTSLDKKQGWHRAKLKDGTGFYWLPPSLPGWAIPASDN
FT                   KPSPENTNQTSPSVDCEQILKDFSDYASTETDKKKLIERYQRDWQLMAGNEEAQAKCVQ
FT                   VMNIRVNELKQAA"
     atggatttga acaaattcga tgagccattc agccctgaag atatagaatg gagaatacag        60
     caaagcggta aaacacgcga tggcaaggtg tgggctatgg tgctggctta tgtcacgaac       120
     agggcaatca tgaaacgcct tgacgatgtt tgcggcaaag caggatggcg caatgaatac       180
     cgagatattc ccaacaacgg aggcgttgaa tgcggcatat caatcaggat tgattccgaa       240
     tgggtaacca aatgggatgc tgctgaaaac acgcaggtag aagccgtaaa aggtggtcgt       300
     tccggtgcaa tgaagcgcgc tgccgttcag tggggaatcg gtcggtatct gtataacctt       360
     gaggaaggtt tcgcacaaac atctctcgat aaaaagcagg gatggcacag ggcaaaactc       420
     aaggatggaa caggatttta ctggctccct ccatcgctgc cgggatgggc aatcccagca       480
     tcagataaca aaccatcacc agaaaatacc aaccagacat ctccatcggt tgactgcgaa       540
     caaatcctga aagacttcag cgattatgca tcaacagaaa ctgacaagaa aaaactcatc       600
     gagcgttatc agcgtgactg gcaattaatg gctggcaacg aggaggcaca ggctaaatgc       660
     gttcaggtaa tgaacatcag agttaacgaa ctaaaacagg cggcataa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page