(data stored in ACNUC7421 zone)

EMBL: FM180568.PE666

FM180568.PE666       Location/Qualifiers
FT   CDS_pept        complement(727459..727704)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0666"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08214"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR2"
FT                   /protein_id="CAS08214.1"
FT                   /translation="MRLYRIPITLHSRRFRYAIKQKEHPMQQFAIAGAASVRPFNPILS
FT                   VQHSRKNILTGADFKQPRMKSLLEKLWDILKQQGRP"
     gtgcggcttt accgcatacc aataacgctt cactcgaggc gttttcgtta tgcaatcaaa        60
     cagaaggagc atcctatgca acagttcgct attgcagggg cggcatcggt tcgccctttc       120
     aacccgattt tatcggtaca gcattcacga aaaaatattt taaccggagc agactttaaa       180
     caaccaagaa tgaaaagctt gctcgaaaag ctttgggata ttttgaaaca acaaggccgt       240
     ccatga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page