(data stored in ACNUC7421 zone)

EMBL: FM180568.PE667

FM180568.PE667       Location/Qualifiers
FT   CDS_pept        complement(727705..728073)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0667"
FT                   /product="predicted single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08215"
FT                   /db_xref="GOA:B7ULR3"
FT                   /db_xref="InterPro:IPR024252"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR3"
FT                   /protein_id="CAS08215.1"
FT                   /translation="MSNIKKYIIDYDWKASIEIEIDHDLMTEEKLHQINNFWSDSEYRL
FT                   NKHGSVLNAVLIMLAQHALLIAISSDLNAYGVVCEFDWNDGNGQEGWPPMDGSEGIRIT
FT                   DIDTSGIFDSDDMTIKAA"
     atgtcaaaca tcaaaaaata catcattgat tacgactgga aagcatcaat agaaattgaa        60
     atcgaccatg acttaatgac agaggaaaaa cttcaccaga ttaataattt ctggtcagac       120
     tctgaatacc gactcaataa acacggctct gtattaaatg ctgtattaat catgctggcg       180
     caacatgctc tgcttatagc aatttcaagc gacttaaatg catatggtgt tgtgtgtgag       240
     ttcgactgga atgatggaaa tggtcaggaa ggatggcctc caatggatgg tagcgaagga       300
     ataagaatta ccgatatcga tacatcagga atatttgatt cagatgatat gactatcaag       360
     gccgcctga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page