(data stored in ACNUC7421 zone)

EMBL: FM180568.PE668

FM180568.PE668       Location/Qualifiers
FT   CDS_pept        complement(728253..728576)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0668"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08216"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR4"
FT                   /protein_id="CAS08216.1"
FT                   /translation="MEALVVERSEDGYWTHPEYANLFGDREVISADEFRSFCKQHGIES
FT                   SIVEMENDNNQTVIDAYFEDGNPNISGWEPSMPDGEGWFVGSIHDTEDGPICVWFRNVD
FT                   KAA"
     atggaagcat tagtagtaga gcgaagcgag gatggctact ggacgcaccc agaatacgcc        60
     aacctgtttg gggatagaga ggtaatttca gctgatgagt tcagatcttt ctgcaagcag       120
     catggcattg aatcatcaat tgttgaaatg gaaaacgaca acaatcaaac ggtaattgac       180
     gcgtattttg aagatgggaa tccaaacatc agtggatggg agccaagcat gccagatgga       240
     gaaggatggt ttgtcggttc gattcacgat acagaagacg gtccgatctg cgtttggttc       300
     agaaatgtag ataaggccgc atag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page