(data stored in ACNUC7421 zone)

EMBL: FM180568.PE669

FM180568.PE669       Location/Qualifiers
FT   CDS_pept        complement(728639..728863)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0669"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0669"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08217"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR5"
FT                   /protein_id="CAS08217.1"
FT                   /translation="MNQTYIPSCLRNLPKQKAKPRKQAIKDAKAEVIDQAIQLLREELR
FT                   SGKLEGMMMPYQRGYLSAISKLEVLKSEL"
     atgaatcaga catacattcc atcatgcttg agaaatctgc caaagcagaa agcaaagccc        60
     cgcaagcaag ccataaagga cgctaaggca gaggttattg atcaagcaat acaattgctc       120
     agggaggagt taagaagtgg caagctcgaa ggaatgatga tgccctatca gcgcggatat       180
     ctatcggcga ttagtaagtt ggaagtattg aagagtgaat tatga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page