(data stored in ACNUC7421 zone)

EMBL: FM180568.PE671

FM180568.PE671       Location/Qualifiers
FT   CDS_pept        complement(729618..730442)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0671"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0671"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08219"
FT                   /db_xref="GOA:B7ULR7"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR7"
FT                   /protein_id="CAS08219.1"
FT                   /translation="MITSLQGWEAIAKQSEGVLQELTGANILDISVHVARLEAGSLYED
FT                   IVIKLLFGSQEEMDKFLAGAHAKIGNGKMRNALVGAVVIGLVGYGLVLATKAMAPSNTS
FT                   HFEANNNTIINIGAGEANISPDRLQAIIESTVTNKKTLAKSSIKTLAPARADEGSTMVI
FT                   GTGGGTVTIPAETIKKAPTEVVFTPESYTQDHFDVDVEIRALDLDNPEKGWAAVIPGLI
FT                   DRRVNMVLGPNVNPSDFAGKFAVRADITITYQLKSSDKKYQPKEVFIKEIIK"
     gtgattacct cccttcaagg gtgggaggcc atcgcaaaac aatcagaagg tgttttgcag        60
     gaactgacag gggctaatat ccttgatata tcggtgcatg ttgcgcgatt agaagcagga       120
     agcctttatg aagatattgt tattaaactc ctctttggta gccaagaaga aatggacaag       180
     tttcttgctg gcgctcatgc aaagatcgga aatgggaaaa tgagaaacgc tctcgttggt       240
     gctgttgtta ttggtctggt tggatatggc ttagttctag caactaaggc tatggctcca       300
     agcaacacct cccactttga agcaaataac aatacaatca tcaatattgg tgccggtgag       360
     gctaatattt cacctgaccg tcttcaagca atcatagaaa gcacggtaac caataagaag       420
     actcttgcca aaagttccat taagacgctt gccccagcta gggcagacga aggatctacg       480
     atggtcatag gtacaggggg tggtacagtg accattcccg ctgaaaccat taaaaaagcc       540
     ccaactgaag ttgtcttcac accagagtca tatactcagg atcattttga tgttgatgtt       600
     gaaatccgtg cattagacct cgacaatcca gagaaaggtt gggccgctgt tatccctgga       660
     ttaatagatc gaagagtaaa tatggttctt ggccccaacg taaacccatc agattttgca       720
     ggtaaatttg ctgtacgtgc tgatataaca ataacgtacc agctcaaatc atcagataaa       780
     aaataccaac cgaaagaagt ctttataaaa gaaataatca aataa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page