(data stored in ACNUC7421 zone)

EMBL: FM180568.PE672

FM180568.PE672       Location/Qualifiers
FT   CDS_pept        complement(730647..731354)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0672"
FT                   /product="predicted repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08220"
FT                   /db_xref="GOA:B7ULR8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR8"
FT                   /protein_id="CAS08220.1"
FT                   /translation="MVQNEKVRKEFAQRLAQACKEAGLDEHGRGMAIARALSLSSKGVS
FT                   KWFNAESLPRQEKMNALAKFLNVDVVWLQHGTSLNGANDEDTFSIVGKLKKGLVRVVGE
FT                   AILGVDGAIEMTEERDGWLKIYSDDPDAFGLRVKGDSMWPRIKSGEYVLIEPNTKVFPG
FT                   DEVFVRTIEGHNMIKVLGYDRDGEYQFTSINQDHRPITLPYHQVAKVEYVAGILKQSRH
FT                   LDDIEAREWLKSS"
     atggttcaga atgaaaaagt gcgcaaagaa ttcgcccagc ggctagcgca agcctgtaaa        60
     gaagctggtc ttgatgaaca tggtagggga atggccatag cccgtgccct ttctctttcg       120
     tccaaaggcg ttagcaaatg gtttaatgct gagtctttac cacgccagga aaaaatgaat       180
     gcgcttgcga aatttctaaa cgttgatgtt gtttggcttc agcacggcac ttcgttaaat       240
     ggagcgaatg atgaagatac tttttcaatt gttggcaaat taaaaaaagg gttagtgcgc       300
     gtggttggtg aggcaattct tggtgttgat ggtgccatcg agatgaccga agagcgcgat       360
     gggtggctca agatttatag cgatgatcca gatgcctttg gtcttcgtgt aaaaggagac       420
     agcatgtggc ccagaataaa atcaggagaa tatgtactca ttgagcctaa caccaaagta       480
     ttcccaggtg atgaggtgtt tgtcagaacc attgaagggc acaacatgat caaggttctt       540
     ggctatgaca gagacggaga ataccaattt acaagcatca accaagacca caggccaata       600
     acgttgcctt atcatcaagt agcaaaggtg gagtatgtag ctggtattct gaagcaatct       660
     cgccacctag atgacatcga ggccagggaa tggctgaaaa gttcatga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page