(data stored in ACNUC7421 zone)

EMBL: FM180568.PE673

FM180568.PE673       Location/Qualifiers
FT   CDS_pept        731433..731660
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0673"
FT                   /product="predicted antirepressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0673"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08221"
FT                   /db_xref="GOA:B7ULR9"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR9"
FT                   /protein_id="CAS08221.1"
FT                   /translation="MQNLDEPIKGVGIPEVAKACGVSERAVYKWLKNGFLPKTEFFGKT
FT                   KYASKIEEISGGKYQASEMLEISKKNLLAA"
     atgcaaaatc ttgatgagcc gattaaaggt gtcggcatcc ctgaagttgc gaaggcttgt        60
     ggagttagcg aaagggctgt ctataagtgg ctcaaaaacg gcttcctccc taagactgag       120
     ttttttggga aaacgaaata cgcatcaaaa atcgaagaga tttctggtgg caaatatcaa       180
     gcaagcgaaa tgcttgaaat aagcaaaaag aaccttctgg cagcataa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page