(data stored in ACNUC7421 zone)

EMBL: FM180568.PE674

FM180568.PE674       Location/Qualifiers
FT   CDS_pept        731767..732066
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0674"
FT                   /product="predicted regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0674"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08222"
FT                   /db_xref="GOA:B7ULS0"
FT                   /db_xref="InterPro:IPR007933"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULS0"
FT                   /protein_id="CAS08222.1"
FT                   /translation="MEQTNYSKLSQRDVDRAETDLLINLSAITQRGLAKMIGCHESKIS
FT                   RTDWRFIASVLCAFGMASDISPISRAFKYALDGLTNKKRPVCKTERSDQIQMEF"
     atggaacaaa caaattacag caaactatca cagcgcgacg ttgatcgcgc agaaacagat        60
     ttacttatca acctgtcagc gattacccag cgcggtttgg caaagatgat tggctgtcat       120
     gaatcgaaga taagcagaac ggactggagg tttattgctt cggtcttgtg tgctttcgga       180
     atggcatcag acataagtcc gattagcagg gcttttaagt atgcgcttga tggactcacc       240
     aataaaaaac gcccggtgtg caagaccgag cgttctgatc aaatacaaat ggaattttaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page