(data stored in ACNUC7421 zone)

EMBL: FM180568.PE676

FM180568.PE676       Location/Qualifiers
FT   CDS_pept        733113..734993
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0676"
FT                   /product="predicted replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0676"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08224"
FT                   /db_xref="GOA:B7ULS2"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULS2"
FT                   /protein_id="CAS08224.1"
FT                   /translation="MTPSELSDLLWAQVDRVAPHLLPNGKKEGHEWVAGNVNGDKGNSL
FT                   KVNLSGKKKWADFAEGDGGDMLDLWMACRGINLHQAMQEAKAFLGIKDDDHHFDAKREK
FT                   KFSRPDRKKIARYVTRTESHLEYLQSRGISPEVVKRYEVVSGKVWNGERELDALVLPYK
FT                   RDGELLQVKRISTERPDGKKVIMAEGDCEPCLFGWQALDAGVRAVVLCEGEIDCMSYAQ
FT                   YGISALSVPFGGGKGAKQQWIEFEYHNLDRFEEIFISMDVDDVGREAAREIASRLGEHR
FT                   CRLVTLPYKDINECLMNGVTEDEIWQYIGTASYFDPEELYSAREFYQDTINAFYGKQQY
FT                   LFNPPWESLADKFQFREAELTLVNGVNGHGKTEVVGHMALEAMRQGVKTCIASLELKPG
FT                   ILLKRLTRQATCCKMPPVLEIDSAFKFYDERLWVFGLTGTAKADRLIEIFDYARRRYGI
FT                   QLFIIDSLMKCGIGDDDYNGQKAFVDSICDFKNKTNSHVILVTHSRKGDSEEKPTGKMD
FT                   VKGSGAITDLTDNLFIIWRNKARERALQRVQSGEKMSEKDEQLLASPASVLMLEKQRNG
FT                   EGWEGGVPLFLDEQSHQFLQLESGSPYIYIANMPKSEYDESWRQENVTEY"
     atgacgccaa gtgaacttag cgacctgctt tgggcgcagg ttgacagggt ggctccgcac        60
     ctgttgccaa acggcaagaa agaggggcat gagtgggttg ccggtaacgt caacggtgac       120
     aagggaaaca gccttaaggt caaccttagc ggcaagaaaa aatgggctga tttcgctgag       180
     ggagacggcg gtgacatgct tgatttgtgg atggcatgtc gaggaattaa cctgcatcag       240
     gctatgcagg aagcgaaagc atttctcggt atcaaggatg acgatcacca tttcgatgcc       300
     aaacgtgaga agaaattctc cagacctgat cgcaagaaaa tcgcccgcta cgttaccaga       360
     acagaatccc atcttgagta cctgcaatcg cgtggcatat cgccagaagt cgtaaagcgc       420
     tacgaggttg tcagcggcaa ggtgtggaat ggagaacgag aacttgatgc actggtgctt       480
     ccgtacaaac gcgatggtga gttgttgcag gtcaagcgaa tcagcactga gcgaccggac       540
     gggaagaaag tcattatggc agaaggtgat tgcgaacctt gtctgttcgg atggcaggct       600
     ctggacgctg gcgtgagggc ggttgtactt tgcgaaggcg aaattgattg tatgagctat       660
     gcgcaatacg gcatctcggc gttatccgtg ccgtttggtg gcgggaaagg cgctaagcag       720
     cagtggattg agtttgagta tcacaacctc gacaggtttg aggaaatatt catctcgatg       780
     gacgttgatg atgttggtcg tgaagccgca agggaaatcg caagccgact cggtgaacat       840
     cgttgccgtc ttgttactct gccgtacaaa gacatcaacg aatgcctgat gaacggtgtt       900
     accgaggatg aaatctggca gtacatcggc acggcatcct acttcgatcc cgaagaactc       960
     tacagcgcgc gagagtttta ccaggacact atcaacgctt tctacggcaa gcagcagtat      1020
     ctgtttaatc caccgtggga atctctggca gataaattcc agttccgtga ggccgagttg      1080
     acgctggtca atggtgtgaa cggtcacgga aaaacggagg ttgtcgggca tatggcactt      1140
     gaggcaatgc gtcagggtgt gaagacgtgc atcgcgtcac ttgagctgaa gccaggcatt      1200
     ctccttaagc gacttacccg tcaggcgacg tgctgcaaga tgccgccagt gctggaaatt      1260
     gactctgcat ttaaatttta tgacgaaaga ctttgggtgt ttggcctgac cggaacggcg      1320
     aaagccgaca ggctgatcga aatattcgac tacgctcgcc gccgatacgg catccagtta      1380
     ttcatcatcg acagcctgat gaaatgtggc ataggcgacg atgactataa cgggcagaag      1440
     gcgtttgttg actcgatttg cgacttcaaa aacaaaacaa actcccacgt cattctcgtt      1500
     actcactcgc gaaaaggaga cagcgaagaa aaaccaaccg ggaaaatgga cgtaaaaggc      1560
     tctggagcga taacagacct gacagacaac cttttcatca tctggcgtaa caaggctcgc      1620
     gagagagcgt tacagagagt tcagagtggt gaaaagatgt cagagaagga cgaacagcta      1680
     ctggcatctc cggcatctgt tttgatgctt gaaaaacaac gtaacggcga aggttgggaa      1740
     ggtggtgtcc cgttgttcct tgacgagcaa tcgcaccagt tcctgcaact tgaatcggga      1800
     tcgccatata tctacatcgc caatatgccg aaatcggaat atgacgagtc gtggcgacag      1860
     gaaaacgtga cggagtatta a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page