(data stored in ACNUC7421 zone)

EMBL: FM180568.PE68

FM180568.PE68        Location/Qualifiers
FT   CDS_pept        75570..76523
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0068"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07616"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB3"
FT                   /protein_id="CAS07616.1"
FT                   /translation="MKRTLMSCAVASLLVSGSALAAWPEKPIQIIVPWGAGGNTDTVAR
FT                   LVAEGLQKELKVNVNVVNRTGGAGVVGHDAIAKAKADGYTLGIATVEITMMHHQGMTAL
FT                   TYQNYTPITRLAVNLGGVQVAANSQFENIVQMTDYIKANPGKLKASGSGLNSGWHLNLI
FT                   GMLDSMGLPPSAVTWVPSEGSSSALMELVSGGIDFTTSSPGEAKSMVDAKMVRNLATMA
FT                   EKSAGLYKDLPVFQQATGYKYHLATWNALVVPAGTPEEVSQKLTAAMQAVFAQGKLQEF
FT                   ATKQGFEVYPLYGKEMTTFMADEDARYGKLITKIKG"
     atgaaacgaa ccctgatgag ttgtgccgtt gcttcactgc tggtttcagg ttccgcgctg        60
     gctgcatggc cagaaaaacc aatccaaatc attgtcccct ggggcgcggg aggaaatacc       120
     gatactgttg cacgcctggt ggcagaaggg ctgcaaaaag agttgaaagt gaatgtcaac       180
     gtggtgaatc gcacgggagg tgctggggtg gttggccatg atgccattgc gaaagctaaa       240
     gcggatggct atactctggg aattgcgacg gtagaaatca ccatgatgca ccatcagggg       300
     atgacggcgt taacgtatca gaactacacg ccaattacac ggctggcagt gaatctggga       360
     ggcgtgcaag tcgcagcaaa ttcgcagttc gaaaatatcg tccagatgac cgactacatc       420
     aaggcgaatc caggtaagtt aaaagcatcg ggtagcgggt taaattccgg ctggcatcta       480
     aacttgatag gtatgctcga cagtatgggg cttccgcctt ctgccgtgac ctgggtgcct       540
     tctgaaggtt ccagttctgc actgatggaa ctggtttccg gtggtataga ttttacaacg       600
     tcatcaccgg gcgaagcgaa aagtatggtc gatgccaaaa tggtgcgtaa tttagcgacc       660
     atggcagaaa aatcggcagg gctttataaa gatcttccag tattccaaca agcaactggc       720
     tataaatatc atttggcgac atggaatgcc ttagtggttc cggcgggtac tcctgaagag       780
     gtctcacaaa aattaactgc cgctatgcag gcagtgtttg cgcaggggaa attacaagaa       840
     ttcgctacca aacagggttt tgaagtttac ccgctgtatg gcaaagagat gacgacattt       900
     atggcagatg aagatgccag atacggaaaa ttaataacca aaatcaaagg ttaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page