(data stored in ACNUC7421 zone)

EMBL: FM180568.PE681

FM180568.PE681       Location/Qualifiers
FT   CDS_pept        736389..736781
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0681"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0681"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08229"
FT                   /db_xref="GOA:B7ULS7"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULS7"
FT                   /protein_id="CAS08229.1"
FT                   /translation="MVISRYGKITFKHFQDNPTWAAAAGYDFNYFDCLSVACIATTNVA
FT                   NNIIDEFLDFPDYQVRELPAFFVKVSVATALLFILLFAYPLLAVFVYVRCKHSQNEYSG
FT                   EHTDITSQNMRVWLRRCQEKWGRSHG"
     atggtgatta gccgatacgg aaaaataacg tttaaacatt ttcaagacaa tccaacatgg        60
     gctgctgcgg ctggatatga ctttaattat tttgattgtc tgtcagtcgc atgtattgca       120
     actaccaatg ttgctaacaa cataatcgat gaattcttgg attttccaga ctatcaggtc       180
     agagagttgc ctgcattttt tgtgaaagta tctgttgcta cagctctgtt atttattttg       240
     ttattcgcat atccattgct tgccgtattt gtttatgtga gatgcaagca ctcacaaaat       300
     gaatacagcg gagagcatac cgatattacc agccaaaata tgcgagtgtg gttgaggaga       360
     tgccaagaga aatgggggag aagtcatggc taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page