(data stored in ACNUC7421 zone)

EMBL: FM180568.PE682

FM180568.PE682       Location/Qualifiers
FT   CDS_pept        736774..737064
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0682"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0682"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08230"
FT                   /db_xref="InterPro:IPR010774"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULS8"
FT                   /protein_id="CAS08230.1"
FT                   /translation="MANLRKEARGRECQVRIYGVCNGNPETTVLAHYRMAGICGTGMKP
FT                   DDLIGAWACSDCHAEIDRRTRILDNKDARLYHLEGVIRTQAILLKEGKIKS"
     atggctaacc tacgcaaaga agcgcgcgga agagaatgcc aggtacgtat ttacggcgta        60
     tgcaatggaa atcctgaaac tacagttctg gcacattacc ggatggctgg aatttgcgga       120
     acgggaatga aacctgacga cctgatcggc gcatgggctt gtagtgactg ccacgcggag       180
     atcgaccgac gcacaaggat tctcgacaac aaagacgcca gactttacca cctcgaaggc       240
     gtgatcagga cgcaggcgat actgctgaag gaggggaaga ttaagtcatg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page