(data stored in ACNUC7421 zone)

EMBL: FM180568.PE683

FM180568.PE683       Location/Qualifiers
FT   CDS_pept        complement(737195..737554)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0683"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0683"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08231"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULS9"
FT                   /protein_id="CAS08231.1"
FT                   /translation="MTLAFAVSVVLEHCSSCAGKHPRHFGLIASCLDKKLWYRLNCGVH
FT                   AFSSSVIFIPSRPPGTFTPRITRMSSNCSSSSANPAWIRESSKPFRMLSRSRRRESGTS
FT                   AMTLMRSRDLVKMSN"
     atgacgctcg cctttgctgt ctcggttgta cttgagcact gttcctcttg cgcaggaaag        60
     catcctcgcc acttcggtct gattgcctcg tgtctggata agaagctctg gtatcgtttg       120
     aattgtggcg ttcatgcgtt ctccagttcg gtgattttta ttccaagccg tccgcctggt       180
     actttcacac cacgaattac gcgaatgtca tcgaattgct cgtcgtcttc cgcaaatccg       240
     gcgtggataa gggagtcgag taaacctttc aggatgttgt cgaggtcgcg gcggcgggag       300
     tctggaacgt ctgcgatgac tttgatgcgg agtcgtgatt tggtgaaaat gtctaactaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page