(data stored in ACNUC7421 zone)

EMBL: FM180568.PE684

FM180568.PE684       Location/Qualifiers
FT   CDS_pept        complement(737820..738779)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0684"
FT                   /product="SfpA (systemic factor protein A)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0684"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08232"
FT                   /db_xref="InterPro:IPR018707"
FT                   /db_xref="InterPro:IPR037107"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULT0"
FT                   /protein_id="CAS08232.1"
FT                   /translation="MKKSVIAGVFIALSFTTCSAIANSLALSLANDDAGKFQPILNDIY
FT                   GNKHENRDDYSQGLFLGYSHDISDSSQLSLHIAQDIYSPSGSNKRHNTAVTGDRAFSAY
FT                   THTGIEWNSLANDWIRYRLGTDIGVVGPDAGGQKVQNKAHEIIGAEKYHAWDDQIENRY
FT                   GYTVKGMLSMTPSMDILGANVGLYPEVSAVTGNLFQYVAYGATIAIGNDKTFNSDNGFG
FT                   LLAPRGLMHMSDTSGFKYKIFAGMERRDVNRNYTLEGKTIQTKQTTVSLNKTVDEYQVG
FT                   ATIGYAPVAFTLAFNKVTSEFKTGDDYSFINGAITFFF"
     atgaaaaaaa gtgtcatcgc tggcgtcttt attgctctgt catttaccac gtgttcagct        60
     atcgcgaaca gccttgcatt atcattagca aatgatgatg cagggaagtt tcaaccaata       120
     cttaatgata tttatggcaa taaacatgaa aacagagatg attactcaca aggcttattt       180
     ctgggatata gccacgatat ctcagactcg agccaattat ctctccatat tgcgcaagat       240
     atttactctc catcaggcag taataaaaga cacaacacag ctgtaactgg agacagagct       300
     tttagtgcat acactcacac tggtattgaa tggaactccc ttgcgaatga ctggattcgc       360
     tatcgattag gtactgacat aggtgttgtt ggccccgacg caggcggtca gaaagtacaa       420
     aataaagctc atgagattat tggggcagaa aaatatcatg catgggatga tcaaatagag       480
     aatcgctacg gttatactgt aaaagggatg ctatccatga caccaagtat ggatatttta       540
     ggtgctaatg ttggattata ccctgaagtt tctgctgtta ctggaaactt atttcaatat       600
     gtagcatatg gcgcaaccat tgccattggt aatgataaaa ccttcaattc ggataatggc       660
     tttggtctgc tggctccccg tggtttaatg catatgtccg atacaagcgg attcaaatac       720
     aagatttttg caggtatgga aagacgagat gtcaatcgca actatactct cgaaggaaaa       780
     acaatacaga cgaaacaaac aacagtatcg ctaaacaaaa ctgttgatga atatcaagtt       840
     ggcgcaacaa ttgggtatgc acctgtagcc ttcacactag catttaataa agtaacatca       900
     gaattcaaga caggggatga ctattcattt ataaatggag caatcacctt ctttttttaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page