(data stored in ACNUC7421 zone)

EMBL: FM180568.PE686

FM180568.PE686       Location/Qualifiers
FT   CDS_pept        740156..740872
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0686"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0686"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08234"
FT                   /db_xref="GOA:B7ULT2"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULT2"
FT                   /protein_id="CAS08234.1"
FT                   /translation="MKDGALLRSSSLFIAYMGCLGWGSAYFYGWGTSFYYGFPWWIVGA
FT                   GVDDVARSLFFAVIVIAIFLIGWGIGVVFFFAVKRKHSMQELNVFRLYFAVELLFVPAI
FT                   IEFSILRQKIQVPLLLLSAAIALAVTISIRSYGRFLSVSCFYDKPFIKKHFFEIVMIAF
FT                   VAYFWLFSFLTGYYKPQFKKEYEMINYNDGWYYVLARYDNCLVLSTSFNAGSKRFVIYQ
FT                   SAQDKNLQVDIVRTRI"
     atgaaggatg gtgcgctgct caggagttct tcacttttta ttgcctacat gggatgcctt        60
     ggatggggga gtgcttattt ctatggatgg ggtacttctt tttactacgg cttcccatgg       120
     tggattgtag gtgcaggtgt tgatgatgtt gccagaagtt tattttttgc agttatcgtc       180
     attgctatat ttcttatcgg ttggggtatt ggtgttgtat tctttttcgc agtgaaaaga       240
     aaacattcta tgcaagagct aaatgtattt cgcctttatt ttgctgtgga attattgttt       300
     gtgccggcaa ttattgagtt ttctatattg agacagaaga ttcaggtacc tcttttgcta       360
     ctgtcagcag cgattgcgct ggcggttaca atttcgataa gatcttatgg gcgattttta       420
     tcggtatcat gcttctatga taagccattt ataaaaaaac atttttttga gattgtgatg       480
     attgcttttg tggcatattt ttggcttttt tcatttctga caggatatta caaaccacag       540
     tttaagaaag aatatgaaat gattaattat aatgatggtt ggtattatgt tcttgctcgt       600
     tatgataatt gtctggtttt gtctacttct ttcaatgcag gtagtaaaag gtttgtcatt       660
     tatcaatcag cacaagataa gaatcttcag gttgatattg taaggaccag aatttaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page