(data stored in ACNUC7421 zone)

EMBL: FM180568.PE687

FM180568.PE687       Location/Qualifiers
FT   CDS_pept        740958..741116
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0687"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0687"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08235"
FT                   /db_xref="GOA:B7ULT3"
FT                   /db_xref="InterPro:IPR025169"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULT3"
FT                   /protein_id="CAS08235.1"
FT                   /translation="MFYKLCLLAVVILLLVMVMMDFTSRIMLVLTDGALVCGIVVLLWP
FT                   MMKEQNE"
     ttgttttata aactgtgtct gcttgctgtt gtgatcctgc ttttagtgat ggtgatgatg        60
     gatttcacca gcaggataat gttggtactg actgatggcg ctctggtctg cggcattgtg       120
     gtattgctgt ggccgatgat gaaagaacag aatgaataa                              159
//

If you have problems or comments...

PBIL Back to PBIL home page