(data stored in ACNUC7421 zone)

EMBL: FM180568.PE688

FM180568.PE688       Location/Qualifiers
FT   CDS_pept        741415..743265
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0688"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0688"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08236"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULT4"
FT                   /protein_id="CAS08236.1"
FT                   /translation="MSIKHYDVVRAASPSDLAEKLTHKLKEGWQPYGGPVAITPYTLMQ
FT                   AVAIEGEPQVGPSSEPDWYYVIVLAGQSNAMAYGEGLPLPDSYDAPDPRIKQLARRSTV
FT                   TPGGAACRYNDIIPADHCLHDVQDMSTLNHPRADLSKGQYGCVGQGLHIAKKLLPYIPN
FT                   NAGILLVPCCRGGSAFTQGAEGTFSESTGASQDSARWGVGKPLYQDLISRTKAALQKNP
FT                   KNVLLAVCWMQGEFDMSAATHVQQPALFTAMLTQFRADLSVFNAQCHGGSAADVPWVCG
FT                   DTTYYWKNTYATQYDTVYGGYKNRESEGVYFVPFMTDGNGVNTATNAPAEDPDIPVSGY
FT                   YGAASRTNGNQVSSNRPTHFSSWARRSIIPDRLATAILNAAGRTSAFISGKAPEIKPSS
FT                   GGNTPSGPFADTSVRTISLLPAAGEAAAQGWSIKDGGIQLSDGVFKITKQSNKTWSLTH
FT                   PVDDAITLLTQGGRLTCKFRLSGALTNNQFGLGIYLYTDAPVPDGVAMTGTGNPFLMSY
FT                   FTQTTDGRVNLMHHRKAGNTKLGEFGDYGNDWQTLELVFTAGSATVTPKLNGVAGPAFQ
FT                   VIKDSLTLGLNALTLTDVTKNAAYGVEIESLMLEINAPAA"
     atgtcgatta aacattacga tgttgtcagg gcggcgtcgc cgtcagacct tgcggaaaag        60
     ctgacacaca aactgaaaga gggctggcag ccatacggcg gaccggttgc cattacgccg       120
     tacacactga tgcaggcggt ggctattgaa ggagagccac aggtcggccc ttcatctgag       180
     ccggattggt actacgtcat cgtactggcc gggcaatcca atgccatggc ttacggtgaa       240
     gggcttccgc tgccggattc atacgatgct ccggatccgc gcattaaaca gctggcgcgc       300
     cgcagtacag tgacgccggg cggggctgcc tgcagatata acgatattat tccggctgac       360
     cactgtctgc atgatgtgca ggatatgagt acgctgaatc atccgagggc tgacctgagc       420
     aaagggcagt acggctgtgt cggccagggt ttacatattg ccaaaaaact gctcccgtat       480
     atcccgaata acgcggggat cctgctggta ccatgctgtc gtggtggttc ggcatttacc       540
     cagggcgcgg aggggacatt cagcgagtcc acgggggcca gtcaggattc ggcacgctgg       600
     ggggtgggca agccgttata tcaggatctg atttcccgca caaaagcggc attgcagaaa       660
     aatcccaaaa acgttctgct ggccgtctgc tggatgcagg gtgagtttga catgagcgcc       720
     gccacccacg tacagcaacc tgcgctgttt acagccatgc tgacacagtt tcgtgctgac       780
     ctctccgtgt ttaacgcgca gtgccatggt ggcagtgctg cagatgtgcc gtgggtttgt       840
     ggtgacacga cgtattactg gaaaaataca tacgctaccc agtacgacac cgtgtacggc       900
     gggtataaaa acagggagag tgagggcgtt tattttgtgc ccttcatgac agacggtaac       960
     ggcgtcaata ccgccactaa cgcgccggca gaagatccgg atattccggt atcaggatat      1020
     tacggtgcgg catcgagaac gaatggaaac caggtatcat caaaccgccc gacacatttc      1080
     agttcatggg cgcgcaggag cattattccg gatcgtctgg caaccgctat tctgaacgca      1140
     gccgggcgca cctcagcctt catcagtggt aaggcaccgg aaatcaaacc ctcgtccggc      1200
     ggcaacacgc catcgggtcc gtttgcagat acgtccgttc gcacaatctc cctgctgccg      1260
     gcagccggag aggctgctgc gcagggctgg agcattaagg atggcggaat tcagttgtca      1320
     gatggtgtat ttaagatcac caagcagagc aataaaacct ggtccctgac gcatccggtg      1380
     gatgacgcaa ttaccctgct gacacagggc ggcagactga cctgtaagtt ccgcctgtca      1440
     ggcgcactga ccaacaatca gttcgggctg gggatttatc tgtatacgga tgctcccgtt      1500
     cctgatggtg tggcgatgac gggtaccggt aatccgttcc tgatgtcgta cttcactcag      1560
     accactgacg gcagagtgaa tctgatgcat cacaggaaag ccggaaacac gaagctgggg      1620
     gagttcggcg attacggtaa cgactggcag acgctggagc tggtgttcac cgccggcagt      1680
     gccacggtta ctccgaaact gaatggagtg gctggcccgg cattccaggt tataaaagac      1740
     agtctgacac tgggactgaa tgcgctgacg ctgacggatg ttacaaaaaa tgcagcgtat      1800
     ggcgttgaga tagaaagtct gatgctggag ataaatgcac cggcagcata a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page