(data stored in ACNUC7421 zone)

EMBL: FM180568.PE689

FM180568.PE689       Location/Qualifiers
FT   CDS_pept        743713..743919
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0689"
FT                   /product="predicted holin protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0689"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08237"
FT                   /db_xref="GOA:B7ULT5"
FT                   /db_xref="InterPro:IPR007054"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULT5"
FT                   /protein_id="CAS08237.1"
FT                   /translation="MEKITTGVSYTTSAVGTGYWLLQLLDKVSPSQWVAIGVLGSLLFG
FT                   LLTYLTNLYFKIKEDKRKAARGE"
     atggaaaaaa tcacaacagg tgtgtcatac accacgtcag cggtggggac gggatactgg        60
     ttactgcagc tgctggacaa agtctctccg tcccagtggg tggcaatagg tgtgctggga       120
     agtctgctgt ttggcctgct gacgtatctg acaaatcttt atttcaagat taaagaagat       180
     aagcgtaagg ctgcgagagg tgaataa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page