(data stored in ACNUC7421 zone)

EMBL: FM180568.PE69

FM180568.PE69        Location/Qualifiers
FT   CDS_pept        76572..77009
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0069"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07617"
FT                   /db_xref="GOA:B7UIB4"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB4"
FT                   /protein_id="CAS07617.1"
FT                   /translation="MRIIPVTPLFLLIFAMFIFGWSITQYGGISQYGAGFMPCIISGLL
FT                   LFLAAIDVAIDIKHRHRNKVSLTLDEVKALLLVITVVLLFVLLLDILGFVICSFLLLFI
FT                   LMKIRGVRLLHSVIVSISASLIIWFIFARVLLVAFPEGILF"
     atgcgcataa taccggtaac gccgttattt ctgctgattt ttgccatgtt tatttttggc        60
     tggagcataa cgcaatatgg aggcatatcg cagtatggcg ctggatttat gccttgcatc       120
     atcagtggat tgttgttgtt tttagcggct attgatgtag cgatagatat taaacaccgg       180
     caccgtaaca aagtttcttt aacgcttgat gaagtgaaag cacttttact ggttattaca       240
     gtggtactgc tgtttgtatt attgttagat attctcggtt ttgtaatttg ctcatttttg       300
     ttgcttttta ttttaatgaa aatacgaggt gtcagacttt tgcattccgt tatcgtttcg       360
     atatcggcat ctcttattat ctggtttatt tttgccagag tgttgttggt cgcctttcct       420
     gaaggaatct tgttttaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page