(data stored in ACNUC7421 zone)

EMBL: FM180568.PE693

FM180568.PE693       Location/Qualifiers
FT   CDS_pept        745000..745617
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0693"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0693"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08241"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="InterPro:IPR018877"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULT9"
FT                   /protein_id="CAS08241.1"
FT                   /translation="MLASLGGLVSCAAKVHFKEAGNAMNELIANHDFDFRQLVTAAEGQ
FT                   PVTDTFQIARAFGKRHQHVIRAIKCLRCSEEFSTTHFWAVEKINDLGIFDKKQIYYRMD
FT                   FSGFVMLVMGFNGAKADAVKEAYINAFNWMSAELRKYSESYEAERNAVMLEYMKEKDVA
FT                   SMSGRLLNRWGRTKKPQLLAKLERLERQGQFLLPGFDKGIQA"
     gtgctggcga gcctcggtgg gctggtttcc tgtgcggcaa aggttcattt caaagaagca        60
     ggcaacgcca tgaatgaatt aattgcgaat catgacttcg actttcgcca gttagttacc       120
     gcagcagaag gtcaaccggt aactgacacc ttccagattg ccagggcatt tggtaaacgc       180
     catcagcatg tgattagggc tattaaatgt ttgagatgtt ctgaggaatt ctcgacaacc       240
     catttttggg ccgtcgagaa aatcaatgac ttagggattt ttgacaagaa acagatttac       300
     taccgcatgg actttagtgg cttcgttatg ctggttatgg gatttaacgg ggcaaaagcc       360
     gatgctgtta aagaagccta tatcaatgcg tttaactgga tgtcagcaga actccgtaag       420
     tacagcgaaa gttatgaagc agaacgtaac gccgtaatgc tggagtacat gaaagagaag       480
     gatgtcgcca gcatgtcagg ccgtctgctc aatcgctggg ggagaacgaa aaaacctcaa       540
     ttgcttgcaa agctggaacg tctggagaga cagggacagt ttttattacc gggattcgat       600
     aaaggtattc aagcctga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page