(data stored in ACNUC7421 zone)

EMBL: FM180568.PE695

FM180568.PE695       Location/Qualifiers
FT   CDS_pept        746394..746903
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0695"
FT                   /product="predicted terminase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0695"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08243"
FT                   /db_xref="InterPro:IPR010906"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU1"
FT                   /protein_id="CAS08243.1"
FT                   /translation="MATQTEVARHLSLTDRQLRRLQKLPGAPISNKRGQLDLDAWRDFY
FT                   ISYLRRSKNDVPDGDSEDDYEEKLLIARWELTAEQAVTQQLKNEVSKGKLIDTGFCIFA
FT                   LSKLAMALSSTLDSIPLSMQRQFPDLTPRHLDHLKTLIAKGANQCARAGDKLPDLLDEY
FT                   IRATTE"
     gtggctacgc agactgaagt tgccaggcat ttaagtctga ccgatcgcca gcttcgcaga        60
     ttgcagaaat tgccgggtgc cccgatatca aataagcgag ggcaactgga tctggatgcc       120
     tggcgcgatt tttacatatc gtatctgagg agaagtaaaa acgatgtgcc tgatggcgat       180
     agcgaagacg actatgagga aaaattgctt attgccagat gggaactgac agcagaacag       240
     gctgttacac agcagttaaa aaatgaggtg tcaaaaggaa aacttattga caccgggttc       300
     tgtatttttg ccctcagtaa gctggcaatg gcgttatcca gtacgcttga ttccatccct       360
     ttatccatgc aacgacagtt tcctgattta acaccgcgcc atcttgacca tctgaaaacc       420
     cttattgcga agggggcaaa tcagtgtgcg cgggcggggg ataaattacc ggatttactc       480
     gatgaatata tcagagcaac aactgaataa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page