(data stored in ACNUC7421 zone)

EMBL: FM180568.PE696

FM180568.PE696       Location/Qualifiers
FT   CDS_pept        746875..748803
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0696"
FT                   /product="predicted terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0696"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08244"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU2"
FT                   /protein_id="CAS08244.1"
FT                   /translation="MNISEQQLNNMMSAVTTALQPLIRALPVTPVEWADQNYYLPKESS
FT                   YGEGEWKTLPFQIAIMNSMGNDQIRTVNLIKSARVGYTKMLLGVVGYFIEHKSRNSLLF
FT                   QPTDSAAEDFMKSHVEATIRNVPCLKDLSPWLGRKHRDNTLTLKRFSSGVGFWCLGGAA
FT                   AKNYREKSVDVVCYDELSSFEPDVEKEGSPTLLGDKRIEGSVWPKSIRGSTPKIKGTCQ
FT                   IEKAANESAHFMRFYVPCPHCGEAQYLKFGDESTPFGLKWEKDSPESVFYLCEHHGCVI
FT                   HQSELDQSNGRWICENTGMWTRDGLTFFSARGDEIPPPRSITFHIWTAYSPFTTWVQIV
FT                   YDWLDALKDPNGLKTFVNTTLGETWEEAVGEKLDHQVLMDKVVHYTAAVPARVVYLTAG
FT                   IDSQRNRFEMYVWGWAPGEEAFLVDKIIIMGRPDEEETLLRVDAAINKKYCHADGTEMT
FT                   ISRVCWDTGGIDGEIVYQRSKKHGVFRVLPVKGASVYGKPVITMPKTRNQRGVYLCEVG
FT                   TDTAKEILYARMKADPTPADEATSYAIRFPDDPEIFSQTEAQQLVAEELVEKWEKGKMR
FT                   LLWDNKKRRNEALDCLVYAYAALRVSVQRWQLDLAVLAKSREEETTRPTLKELAAKLSG
FT                   GVNGYSR"
     atgaatatat cagagcaaca actgaataat atgatgagtg ctgtcacaac agcattacag        60
     cccctgataa gggcattgcc ggtgacgcca gttgaatggg ctgatcaaaa ttattatctg       120
     cctaaagaat cttcatatgg tgagggagaa tggaaaacgc tgccattcca gatcgccatc       180
     atgaacagca tggggaatga tcagatccgc actgttaatc tgattaaatc tgcccgtgtt       240
     ggctatacaa agatgttgct gggggtggtc gggtatttta ttgagcataa atcccgaaac       300
     agtctgcttt ttcagcccac ggattctgcc gctgaagatt ttatgaagtc tcacgtggag       360
     gcgacgattc ggaacgtgcc atgcctgaaa gacctttccc catggctggg gcgtaaacat       420
     cgtgacaata ctctcacgct gaaacgcttt tcatcgggcg tcggtttctg gtgcctgggc       480
     ggcgctgccg ccaaaaacta ccgtgaaaaa tccgtggacg tggtctgcta tgacgaactt       540
     tcctcgttcg agccggatgt cgaaaaagag ggctcgccaa ccctgctggg ggataagcgt       600
     attgaggggt cggtgtggcc aaaatccatt cgcggctcga cgcctaaaat caaaggaacc       660
     tgccagatcg aaaaagccgc taacgagtcg gcgcatttta tgcgttttta tgtgccctgc       720
     ccgcactgtg gggaggcgca gtatctgaaa tttggcgatg agtccacgcc ttttgggctt       780
     aaatgggaga aggacagccc cgaaagtgtt ttctacctct gtgaacatca tggctgcgtg       840
     atccatcagt ctgaactgga ccagagcaac gggcggtgga tctgtgaaaa cacgggcatg       900
     tggacccgtg acggtctgac gtttttcagc gcccggggtg atgaaattcc gccgccgcgc       960
     tccatcacgt tccatatctg gacggcgtac agtccgttta ccacctgggt acagatagtc      1020
     tatgactggc tggatgcact gaaagatccc aacggcctga aaacctttgt gaacaccacg      1080
     ctgggcgaga cctgggaaga agccgtgggc gaaaaactcg atcaccaggt actgatggat      1140
     aaggtcgtgc attacacggc ggcggtacct gcccgggtgg tttatctgac ggcgggcatt      1200
     gactcgcagc gaaaccgttt tgagatgtat gtctggggat gggcaccggg agaggaagct      1260
     tttctggtgg ataaaatcat cattatgggc cgtcccgatg aggaagagac gctgttacgt      1320
     gtggatgcgg cgatcaacaa aaaatactgc catgcagacg gaaccgaaat gaccatttcc      1380
     cgtgtctgct gggacaccgg ggggatcgat ggtgaaattg tctatcagag gtcaaaaaaa      1440
     cacggtgttt tccgggtgct gccggtaaaa ggcgcatctg tctatggcaa gccggtgatc      1500
     accatgccga aaacccgcaa tcagcggggc gtgtatctgt gtgaagtggg gacggacacc      1560
     gcaaaagaaa ttctctatgc ccgtatgaaa gccgatccca ctcctgcgga tgaagccacg      1620
     tcgtatgcca tccgttttcc tgatgatccg gagatttttt cgcagacaga ggcgcagcaa      1680
     ctggtcgcgg aagagcttgt ggagaagtgg gaaaaaggaa agatgcgtct gctgtgggat      1740
     aacaaaaagc ggcgtaacga agcgctggac tgcctggtgt atgcctacgc ggcattacgt      1800
     gtgtccgtgc aacgctggca gcttgatctg gctgtactgg caaaatcccg ggaagaagag      1860
     acgacccggc caaccctgaa agaactggca gcgaagctgt ccggaggagt gaatggttac      1920
     agtcgctga                                                              1929
//

If you have problems or comments...

PBIL Back to PBIL home page