(data stored in ACNUC7421 zone)

EMBL: FM180568.PE697

FM180568.PE697       Location/Qualifiers
FT   CDS_pept        748787..748993
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0697"
FT                   /product="predicted head-tail joining protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0697"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08245"
FT                   /db_xref="GOA:B7ULU3"
FT                   /db_xref="InterPro:IPR004174"
FT                   /db_xref="InterPro:IPR036626"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU3"
FT                   /protein_id="CAS08245.1"
FT                   /translation="MVTVAELQALRQARLDLLTGKRVVSVQKDGRRIEYTAASLDELNR
FT                   AINDAESVLGTTRRRRRPLGVRL"
     atggttacag tcgctgaact gcaggcgctg cgtcaggcgc gccttgattt attaaccggt        60
     aaacgggtgg tgtctgtcca gaaagatggt cgcagaattg aatatacggc ggcttctctg       120
     gatgagctta accgggcgat caatgatgcg gagtcggtac tggggacaac ccgacgtcgc       180
     cgtcgtccgc tgggagtgag gttatga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page