(data stored in ACNUC7421 zone)

EMBL: FM180568.PE698

FM180568.PE698       Location/Qualifiers
FT   CDS_pept        748990..750582
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0698"
FT                   /product="predicted portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0698"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08246"
FT                   /db_xref="GOA:B7ULU4"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU4"
FT                   /protein_id="CAS08246.1"
FT                   /translation="MKRTPVLIDVNGVPLRESLSYNGGGAGFGGQMAEWLPPAQSADAA
FT                   LLPALRLGNARADDLVRNNGIAANAVALHKDHIVGHMFLISYRPNWRWLGMRETAAKSF
FT                   VDEVEAAWSEYAEGMSGEIDVEGKRTFTEFIREGVGVHAFNGEIFVQPVWDTESTQLFR
FT                   TRFKAVSPKRVDTPGHGMGNRFLRAGVEVDRYGRAVAYHICEDDFPFSGSGRWERIPRE
FT                   LPTGRPAMLHIFEPVEDGQTRGANQFYSVMERLKMLDSLQATQLQSAIVKAMYAATIES
FT                   DLDTEKAFEYIAGAPQGQKDNPLINILDKFSTWYDTNSVTLGGVKIPHLFPGDDLKLQT
FT                   AQDSDNGFSALEQALLRYIAAGLGVSYEQLSRDYSKVSYSSARASANESWRYFMGRRKF
FT                   IASRLATQMFSCWLEEALLRGIIRPPRARFDFYQARSAWSRAEWIGAGRMAIDGLKEVQ
FT                   ESVMRIEAGLSTYEKELALMGEDYQDIFRQQVRESAERQKAGLSRPVWIAQAYEQQIAE
FT                   SRRPEEETTPRET"
     atgaaacgaa cgcctgtcct gattgatgtg aacggtgttc cgcttcggga gagcctcagc        60
     tacaacgggg gcggtgcagg atttggcggg caaatggcgg agtggttgcc accggcgcag       120
     agtgccgatg cggccctgtt gcccgcgttg cgtctgggca atgcccgtgc agatgatctg       180
     gtgcgcaata acgggatagc ggccaatgcg gtggccctgc ataaggatca tattgtcggg       240
     catatgtttc tgatcagcta ccgtccgaac tggcgctggc tggggatgcg ggagactgca       300
     gcaaaaagtt ttgtcgatga ggtggaggcg gcctggtcgg aatacgccga agggatgtct       360
     ggcgagatcg acgtggaagg gaaacgcacg tttacggaat ttatccgtga aggtgtgggc       420
     gttcatgcgt ttaacggcga aatctttgtg cagccggtct gggatacgga gagcacgcaa       480
     ctgtttcgta cgcgttttaa agccgtgagt ccgaaacggg tggacacgcc aggacacggt       540
     atggggaacc gttttctgcg ggccggtgtg gaggtcgatc gatatggtcg tgccgttgcg       600
     taccatatct gtgaggatga ttttccgttc tccgggagtg gacgatggga acggatcccg       660
     cgtgaacttc ccaccgggcg tccggccatg ctgcatattt tcgagccggt ggaggacggg       720
     cagacccgtg gggccaacca gttttacagc gtaatggaac ggctgaagat gctcgattcc       780
     ctgcaggcaa cacagcttca gtcggccata gtgaaggcga tgtatgcagc gacgattgaa       840
     agtgaccttg ataccgaaaa ggcctttgaa tatatcgccg gtgcgccgca ggggcagaag       900
     gataatccgc ttattaatat tctggataag ttctccacct ggtatgacac gaatagcgtg       960
     acgctgggtg gtgtcaaaat tccgcacctt ttccccggtg atgatctgaa acttcagacc      1020
     gcacaggatt cagacaatgg attttcggcg cttgaacagg cgctgctgcg gtatatcgcc      1080
     gccggtcttg gcgtttccta cgaacagttg tcccgggatt actcgaaggt cagttattca      1140
     agtgcccgcg cctccgccaa tgagtcgtgg cgctatttta tgggacgacg aaaatttatt      1200
     gcgtcccggc tggccacgca gatgttttcc tgctggctgg aagaggcact tcttcggggg      1260
     attattcgtc cgccacgggc gcgttttgat ttttatcagg cgcgatcagc ctggtcacgg      1320
     gctgagtgga ttggagccgg aagaatggcc attgacgggc tcaaggaagt ccaggaatca      1380
     gtgatgcgca ttgaggccgg actgagcacg tatgagaaag agctggcgct gatgggcgag      1440
     gattatcagg acattttccg ccagcaggtc agggaatctg ctgagcgaca aaaagccgga      1500
     ctctcacgtc cggtgtggat agcgcaggcg tatgagcagc agatagcgga gagtcgcagg      1560
     ccggaagagg agacaacacc ccgtgagacg taa                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page