(data stored in ACNUC7421 zone)

EMBL: FM180568.PE699

FM180568.PE699       Location/Qualifiers
FT   CDS_pept        750572..752077
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0699"
FT                   /product="predicted head protein/prohead protease"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0699"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08247"
FT                   /db_xref="GOA:B7ULU5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU5"
FT                   /protein_id="CAS08247.1"
FT                   /translation="MRRNLSHIIAAAFNEPLLLEPAYARVFFCALGREMGASSLSVPQQ
FT                   QVQFDAPGMLAETDEYMAGGKRPARVYRVVNGIAVLPVTGTLVHRLGGMRPFSGMTGYD
FT                   GIVACLQQAMADSQVRGVLLDIDSPGGQAAGAFDCADMIYRLRQQKPVWALCNDTACSA
FT                   AMLLASACSRRLVTQTSRIGSIGVMMSHVSYAGHLAQAGVDITLIYSGAHKVDGNQFEA
FT                   LPAEVRQDMQQRIDAARRMFAEKVAMFTGLSVDAVTGTEAAVFEGQSGIDAGLADELVN
FT                   ASDAISVMATALNSNVRGGTMPQLTATEAAAQENQRVMGILTCQEAKGREQLATMLAGQ
FT                   QGMSVEQARAILAAAAPQQPVASTQSEADRIMACEEANGREQLAATLAAMPEMTVEKAR
FT                   PILAASPQADAGPSLRDQIMALDEAKGAEAQAEQLAACPGMTVESARAVLAAGSGKAEP
FT                   VSASTTALFERIMANHSPAAVQGGVPQTSADGDADVKMLMAMP"
     gtgagacgta atctttcaca cattattgcc gcagcattca atgaaccgct gcttctggag        60
     cccgcctatg cgcgggtttt cttttgcgcg ctcgggcgcg agatgggggc atcaagtctt       120
     tcggtaccac aacagcaggt acagtttgat gctcccggaa tgctggctga aacggacgag       180
     tacatggccg gaggtaaacg accggcccgt gtttaccggg tggtgaacgg tattgcggta       240
     ctgccggtga ccggcacgct ggtgcaccgg ctggggggga tgcggccatt ttccggaatg       300
     actggctatg acggcattgt cgcctgtctt cagcaggcaa tggcagatag ccaggtgcgg       360
     ggcgtactgc tggacattga cagtccgggc gggcaggccg ccggcgcgtt tgactgcgct       420
     gacatgattt accgcctccg tcagcagaag ccggtctggg cactgtgcaa tgacacggcc       480
     tgttctgcag ccatgctgct ggcgtcggcc tgctcccgac ggctggttac ccagacatcc       540
     cgtatcggct ccattggcgt gatgatgagc catgtcagct atgccggtca tctggcgcag       600
     gccggtgtgg atatcacgct gatttactca ggggcgcaca aggtggatgg caatcagttt       660
     gaagccttac cggcagaggt tcgccaggac atgcagcagc gcattgatgc ggcgcgccgg       720
     atgtttgccg aaaaagtggc catgtttacc ggtctgtctg ttgatgccgt cacgggaaca       780
     gaggccgccg tttttgaagg tcagtccggc attgatgccg ggctggcgga tgaattagtc       840
     aatgcgtcgg atgccatcag tgtgatggcc acggcgctga acagtaatgt cagaggaggc       900
     actatgccgc aattaactgc aacggaagcc gccgcgcagg agaaccagcg agtgatgggg       960
     atcctgacat gccaggaagc gaaaggacgt gaacagcttg ccacgatgct ggcaggacaa      1020
     cagggcatga gcgttgaaca ggcccgggcg attctggccg cggcggcacc gcagcagccg      1080
     gtggcatcca cgcagagtga agccgatcgc attatggcgt gtgaagaagc gaacggtcgt      1140
     gaacaactgg cggcaacgct ggcggcgatg ccggagatga cggtggaaaa agcccgcccg      1200
     atcctggctg cttcaccgca ggcggatgcc ggaccctcac tccgtgatca gatcatggca      1260
     ctggatgagg caaaaggggc tgaggcgcag gctgaacagc tggctgcctg cccgggaatg      1320
     actgtggaga gcgcccgggc tgtgctggct gcgggatcag gtaaggcaga accggtctct      1380
     gcatccacaa ccgccctgtt tgaacgcatc atggcgaacc attcaccggc agcggtacag      1440
     ggtggcgtgc cacagacgtc agcagacggt gatgcggacg tgaaaatgct catggccatg      1500
     ccatga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page