(data stored in ACNUC7421 zone)

EMBL: FM180568.PE70

FM180568.PE70        Location/Qualifiers
FT   CDS_pept        77019..78506
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0070"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07618"
FT                   /db_xref="GOA:B7UIB5"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB5"
FT                   /protein_id="CAS07618.1"
FT                   /translation="MDIFIQALTYINLNAILAIIAATAFGLFVGAIPGLTATMAVALMV
FT                   PFTFFLDPIPALALMIAVGASSIYAGDIPGALLRIPGTPASAAYVADSNELVKQGKVNR
FT                   VLGLGLVSSVIGGVIGSLILMLAAPVLAKFALKFSSYEYTWLSLLGLTCATLVVGNQPL
FT                   KGMVTLCLGLLLACIGYDQISGVPRFTFGQISLLQGVNFIPAMIGLFAISGAIEYYRDK
FT                   ISQVSGAVPQTQTGINLFKGMGQVIWSRKLNLGRSSIIGTLIGALPGAGADIAAWISYA
FT                   ISKKFSRQQELYGHGSEEAIVDSSSSNNASLAGSWIPSLVFGIPGDSAAAIIIGVLYMK
FT                   DMNPGPTLFLFQADKLYAVFILFLIANIALLPLATIAVSFIKRIIWIDKAILYPIILIF
FT                   SIVGAFAIDNSGASVVVMLVMGVLGYWLQRKEYPVSPIILGMILGPMLEKNLLSSMIKS
FT                   NGEWLAFVERPVSMALAVCFFLVVALQGRNIYRSFSR"
     atggatattt ttattcaggc actaacgtat attaatttga atgccattct ggccattatt        60
     gctgctacgg cctttgggtt atttgtggga gccattccag gattgaccgc aacgatggcg       120
     gttgcgctaa tggtaccttt taccttcttt cttgatccta ttcccgctct ggcattaatg       180
     attgccgttg gtgcgtcatc catttatgcc ggagatatcc ccggcgcact tttgcgtata       240
     ccagggacac ctgcttcggc ggcttatgtt gctgattcaa atgaactggt aaagcaaggt       300
     aaggtgaatc gcgtattggg acttgggctg gtgagttcgg tcattggtgg cgtgattgga       360
     tcacttattt tgatgttggc tgcgcctgta ctggcgaaat ttgcccttaa atttagttct       420
     tatgaataca catggctttc tcttttaggc ttaacctgcg cgactctggt tgtggggaat       480
     caaccactga aaggcatggt gaccttatgt ttgggattat tactggcgtg tatcggttat       540
     gatcaaatat ccggggtccc acgttttacg tttgggcaaa tcagcctgtt acaaggggtg       600
     aactttattc ctgcgatgat cggtctgttc gcaatatccg gcgcaattga atattatcgt       660
     gacaaaatta gccaggtaag tggtgctgtg ccacaaacgc aaacggggat taatttattc       720
     aagggaatgg ggcaggtgat ttggtcacga aaattaaatc ttggccgaag tagtattatc       780
     ggtacgctta tcggagcatt gcccggcgct ggagcggata ttgctgcgtg gataagttac       840
     gccatttcaa aaaaattctc tcgccagcag gagttatatg ggcatggatc tgaggaggca       900
     attgttgatt cctcgagcag taacaacgcc agtctggcgg ggagttggat cccttcatta       960
     gttttcggta ttccgggcga ttctgccgct gcaattatca tcggcgtgct ctatatgaag      1020
     gatatgaatc cagggccgac attatttctg ttccaggcag ataaactcta tgccgtattt      1080
     atcttgtttc tgatcgccaa tattgcatta ctaccgttag ccacaattgc ggtcagtttc      1140
     atcaaacgca tcatctggat tgataaagcg attctgtacc cgattattct gattttcagt      1200
     attgtcggtg catttgctat cgataactcg ggtgcctctg tcgttgtcat gttggtcatg      1260
     ggggttcttg gatactggtt acaacgtaag gaatacccgg tttcgcccat tattctgggg      1320
     atgattcttg ggccaatgtt ggaaaaaaac ttattatctt caatgattaa gtctaatggt      1380
     gaatggctgg cgtttgttga gcgcccggta tctatggcac tggctgtctg tttctttttg      1440
     gttgtcgcgt tgcaaggacg caatatctac cgttcattta gccgttaa                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page