(data stored in ACNUC7421 zone)

EMBL: FM180568.PE700

FM180568.PE700       Location/Qualifiers
FT   CDS_pept        752114..752461
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0700"
FT                   /product="predicted head-DNA stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0700"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08248"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="InterPro:IPR036630"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU6"
FT                   /protein_id="CAS08248.1"
FT                   /translation="MVTKTITEQRAEVRIFAGNDPAHTATGSSGISSATPALTPLMLDE
FT                   ATGKLVVWDGQKAGSAVGILVLPLEGTETALTYYKSGTFATEAIRWPESVDEHKKANAF
FT                   AGSALSHAALP"
     atggtgacga aaactatcac tgaacagcgt gcggaagtac gtatttttgc cggtaatgat        60
     ccggctcata ccgccacagg cagcagcggg atttcctcgg caacaccggc actgacgcca       120
     ctgatgctgg atgaggccac cgggaaactg gtggtctggg acggacaaaa agccggtagt       180
     gcggttggca tactggtact gccgcttgaa ggcacagaga cggcgctgac ctattacaag       240
     tcggggacct ttgcgacgga ggcaatccgc tggcctgaaa gtgtggatga acacaaaaag       300
     gccaacgcct ttgccggcag tgccctgagt cacgcggcgc tgccgtaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page