(data stored in ACNUC7421 zone)

EMBL: FM180568.PE701

FM180568.PE701       Location/Qualifiers
FT   CDS_pept        752519..753547
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0701"
FT                   /product="predicted major capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0701"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08249"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU7"
FT                   /protein_id="CAS08249.1"
FT                   /translation="MGLFTTRQLLGYTEQKVKFRALFLELFFRRTVNFHTEEVMLDKIT
FT                   GKTPVAAYVSPVVEGKVLRHRGGETRVLRPGYVKPKHEFNYQQAVERLPGEDPAQLNDP
FT                   AYRRLRIITDNLKQEEHAIVQVEEMQAVNAVLYGKYTMEGDQFEKIEVDFGRSTKNNIT
FT                   QGSGKEWSKQDRDTFDPTHDLDLYCDQASGLVNIAIMDGTVWRLLNGFKLFREKLDTRR
FT                   GSNSQLETAVKDLGAVVSFKGYYGDLAIVVAKTSYVAEDGTEKRYLPEGSLVLGNTAAE
FT                   GIRCYGAIQDAQALSEGVVASSRYPKHWLTVGDPAREFTMTQSAPLMVLPDPDEFVVVQ
FT                   VK"
     atgggattgt ttacgacccg ccagttactc ggttataccg aacaaaaagt gaaatttcgt        60
     gcgctgtttc tggagctgtt tttccgccgt acggtgaatt tccataccga agaggtgatg       120
     ctggacaaaa ttaccggaaa aacgccggtg gcggcctatg tttccccggt tgttgaagga       180
     aaagtgctgc gtcatcgtgg tggtgaaacc cgcgtgttac gtccgggcta cgtcaagccg       240
     aaacacgaat ttaattacca gcaggcggtt gagcgtcttc ccggtgaaga tccggctcag       300
     ctgaacgacc cggcctaccg tcgtctgcgt atcatcactg ataacctcaa acaggaagag       360
     cacgccattg tccaggtgga agaaatgcag gcggtgaatg ccgtgctgta tggcaaatac       420
     acgatggaag gagaccagtt cgagaaaatt gaggtcgatt ttggcaggtc gacgaagaat       480
     aacatcactc agggtagtgg taaggagtgg tcaaaacagg atcgtgacac gttcgatcct       540
     acacatgatc ttgacctcta ctgcgaccag gccagcggtc ttgtgaatat tgccattatg       600
     gacggtaccg tctggcgtct gctgaatggc tttaaattgt tccgcgaaaa actggatacc       660
     cgtcgcggct ctaattcgca actcgaaaca gcggtgaaag acctgggcgc ggtggtgtcc       720
     ttcaaagggt attacggcga tctggccatt gtggtggcaa aaacgtctta tgtggcagag       780
     gacggtaccg aaaaacgtta tctgcctgag ggctcgctgg tcctggggaa tacggcagca       840
     gagggcattc gttgctatgg tgccattcag gatgcgcagg cgttgtccga aggtgtggtg       900
     gcctcttccc gttatccgaa acactggctg acggtagggg atcccgcccg tgaatttacc       960
     atgacgcagt ccgcgccgct gatggtgttg ccggacccgg atgagtttgt ggtggtacag      1020
     gtgaaataa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page