(data stored in ACNUC7421 zone)

EMBL: FM180568.PE702

FM180568.PE702       Location/Qualifiers
FT   CDS_pept        753599..753973
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0702"
FT                   /product="predicted DNA packaging protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0702"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08250"
FT                   /db_xref="InterPro:IPR025147"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU8"
FT                   /protein_id="CAS08250.1"
FT                   /translation="MATKEQNLKRLDELALILGREPDISGSAAEIAQRVAEWEEEMQSS
FT                   GDDVQVMNMDIRERENAAHDVREETSGALTRIRVLTCLHLCGVDGETGESVELADVGRV
FT                   ILIMSSDAKTHVDGGMAVYA"
     atggcaacga aagagcaaaa tctgaaacgg cttgatgaac tggccctgat tctggggcgt        60
     gagccggata tatccgggag tgccgcagag atagcgcagc gggtggcaga atgggaagag       120
     gaaatgcagt catccggcga tgatgtacag gttatgaata tggatatccg ggagagggaa       180
     aacgcggctc atgatgttcg tgaggaaaca tccggcgcgt taacgcgcat cagagttctg       240
     acctgcctcc atctctgtgg cgttgatggt gaaacggggg aatccgttga gcttgcggat       300
     gttggtcggg tgattctgat tatgtcctca gatgcaaaaa cacacgttga tggtggaatg       360
     gctgtttatg cgtga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page