(data stored in ACNUC7421 zone)

EMBL: FM180568.PE704

FM180568.PE704       Location/Qualifiers
FT   CDS_pept        754334..754867
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0704"
FT                   /product="predicted minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0704"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08252"
FT                   /db_xref="InterPro:IPR010633"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULV0"
FT                   /protein_id="CAS08252.1"
FT                   /translation="MAIKGLDQAIENLSRVRKNAIPAASAMAINRVATTAINQSSSQVA
FT                   RETRVSRKLVKERSRLKRATVRNPNARIIVNRGDLPVIKLGIRMPGRRPDSILKAGQHR
FT                   YQRAFIQRLKNGRWHVMQRVVGKNRYPIDVVKIPMAAPLKQAFDENVDRIRRERLPGEL
FT                   AYALKQQLRIAIKR"
     atggcgataa aagggcttga tcaggcgatt gaaaatctga gccgggttcg taaaaacgcc        60
     attccggcgg cttcagcaat ggccattaac cgcgtggcca caacggcgat taatcagtct       120
     tcgtcacagg ttgctcggga gaccagggtg agccggaaac tggtaaagga acggtccaga       180
     ctgaaacggg ccacggtcag aaatccgaat gccagaatta tcgttaaccg cggtgatctc       240
     ccggtgatta agctggggat caggatgccg gggcgtcgtc cggacagcat actcaaagcc       300
     ggtcagcatc gttatcagcg ggcatttatt cagcgattaa aaaatggtcg ctggcatgtc       360
     atgcagcgtg tggtcgggaa aaaccgttac cccattgatg tggtgaaaat cccgatggcg       420
     gccccactga aacaggcgtt tgatgagaat gttgaccgta tccggcgtga acgtctgccc       480
     ggagaactgg catacgcgct gaaacaacaa ctgaggattg cgataaaacg atga             534
//

If you have problems or comments...

PBIL Back to PBIL home page